KEGG   Streptomyces coelicolor: SCO4800Help
Entry
SCO4800           CDS       T00085                                 

Gene name
icmB, SCD63A.11
Definition
(RefSeq) isobutyryl-CoA mutase, small subunit
  KO
K01849  methylmalonyl-CoA mutase, C-terminal domain [EC:5.4.99.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00280  Valine, leucine and isoleucine degradation
sco00630  Glyoxylate and dicarboxylate metabolism
sco00640  Propanoate metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01200  Carbon metabolism
Module
sco_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO4800 (icmB)
   00640 Propanoate metabolism
    SCO4800 (icmB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO4800 (icmB)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     SCO4800 (icmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: B12-binding adh_short_C2 adh_short
Motif
Other DBs
NCBI-GeneID: 1100241
NCBI-ProteinID: NP_628957
Kitasato: SCO4800
UniProt: Q9KY64
Position
5224492..5224908
Genome map
AA seq 138 aa AA seqDB search
MGVAAGPIRVVVAKPGLDGHDRGAKVIARALRDAGMEVIYTGLHQTPEQIVDTAIQEDAD
AIGLSILSGAHNTLFAAVIELLRERDAADILVFGGGIIPEADIAPLKEKGVAEIFTPGAT
TASIVDWVRANVREPAGA
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtggcagccggtccgatccgcgtggtggtggccaagccggggctcgacggccac
gatcgcggggccaaggtgatcgcgagggccctgcgtgacgccggtatggaggtgatctac
accgggctccaccagacgcccgagcagatcgtcgacaccgcgatccaggaggacgccgac
gcgatcgggctgtccatcctctccggtgcgcacaacacgctcttcgccgccgtgatcgag
ctgctccgggagcgggacgccgcggacatcctggtcttcggcggcgggatcatccccgag
gcggacatcgccccgctgaaggagaagggcgtcgcggagatcttcacgcccggcgccacc
acggcgtccatcgtggactgggtccgggcgaacgtgcgggagcccgcgggagcatag

DBGET integrated database retrieval system