KEGG   Streptomyces coelicolor: SCO4824Help
Entry
SCO4824           CDS       T00085                                 

Gene name
folD, SC2A6.09
Definition
(RefSeq) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/5,10-methylene-tetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
sco  Streptomyces coelicolor
Pathway
sco00670  One carbon pool by folate
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SCO4824 (folD)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     SCO4824 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     SCO4824 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH Hydrolase Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 1100265
NCBI-ProteinID: NP_628980
Kitasato: SCO4824
UniProt: Q9K3J6
Position
5253981..5254835
Genome map
AA seq 284 aa AA seqDB search
MTAQILDGKATAAAIKSELTARVAALKERGVTPGLGTVLVGDDPGSQKYVAGKHRDCAQV
GIASIQRELPATATQEEIEAVVRELNEDPACTGYIVQLPLPRGIDENRILELMDPDKDAD
GLHPMNLGRLVLNEPAPLPCTPNGILTLLRRYGVEIKGAEVVVVGRGVTIGRPMPLLLTR
RSENATVTQCHTGTRDLAAHLKRADIVIAAAGSPHLVRPEDVKPGAAVLDVGVSRNAEGK
IMGDVHPGVAEVAAWISPNPGGVGPMTRAQLLVNVVEAAERSAG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccagattctcgatggcaaggccaccgcagccgcgatcaagtccgaactgacc
gcccgcgtggcggcgctgaaggagaggggcgtcacgcccggcctcggcaccgtcctggtc
ggcgacgatccaggcagccagaagtacgtcgccggcaagcaccgcgactgcgcccaggtc
ggcatcgcgtccatccagcgcgaactgccggccacggccacgcaggaggagatcgaggcg
gtcgtccgcgagctgaacgaggacccggcctgtacggggtacatcgtccagctgccgctg
cccaggggcatcgacgagaaccgcatcctcgaactgatggacccggacaaggacgcggac
ggcctgcacccgatgaacctgggccgcctcgtcctgaacgagccggcaccgctgccctgc
acccccaacggcatcctcaccctgctgcgccgctacggcgtcgagatcaagggcgccgag
gtcgtggtcgtcggccgcggcgtcaccatcggccgcccgatgccgctgctgctcacccgg
cgcagcgagaacgccacggtgacccagtgccacaccggcacccgggacctggccgcccac
ctgaagcgcgcggacatcgtgatcgccgcggccggttccccgcacctggtgcggcccgag
gacgtcaagccgggcgcggccgtcctggacgtcggcgtctcccgcaacgccgagggcaag
atcatgggcgacgtgcaccccggcgtggccgaggtggccgcctggatctcccccaacccc
ggcggcgtcggcccgatgacccgggcccagctgctcgtcaacgtggtggaggcggcggag
cgcagtgccggctga

DBGET integrated database retrieval system