KEGG   Streptomyces coelicolor: SCO4827Help
Entry
SCO4827           CDS       T00085                                 

Gene name
mdh, SC2A6.12
Definition
(RefSeq) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
sco  Streptomyces coelicolor
Pathway
sco00020  Citrate cycle (TCA cycle)
sco00270  Cysteine and methionine metabolism
sco00620  Pyruvate metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco00680  Methane metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sco_M00012  Glyoxylate cycle
sco_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO4827 (mdh)
   00620 Pyruvate metabolism
    SCO4827 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO4827 (mdh)
  09102 Energy metabolism
   00680 Methane metabolism
    SCO4827 (mdh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO4827 (mdh)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     SCO4827 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N Stealth_CR1
Motif
Other DBs
NCBI-GeneID: 1100268
NCBI-ProteinID: NP_628983
Kitasato: SCO4827
UniProt: Q9K3J3
Position
5257517..5258506
Genome map
AA seq 329 aa AA seqDB search
MTRTPVNVTVTGAAGQIGYALLFRIASGQLLGADVPVKLRLLEITPALKAAEGTAMELDD
CAFPLLQGIEITDDPNVAFDGANVALLVGARPRTKGMERGDLLEANGGIFKPQGKAINDH
AADDIKVLVVGNPANTNALIAQAAAPDVPAERFTAMTRLDHNRALTQLAKKTGSTVADIK
RLTIWGNHSATQYPDIFHATVAGKNAAETVNDEKWLADEFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVYTWVNGTAEGDWTSMGIPSDGSYGVPEGIISSFPVTTKDGSYEIVQGLD
INEFSRARIDASVKELSEEREAVRGLGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcactcccgtgaacgtcaccgtcaccggcgcggccggccagatcggttacgcc
ctgctcttccgcatcgcctccggccagctgctcggcgcggacgtgccggtcaagctgcgc
ctcctggagatcaccccggcgctcaaggccgccgagggcaccgcgatggagctggacgac
tgcgcgttcccgctgctccagggcatcgagatcaccgacgacccgaacgtggccttcgac
ggcgccaacgtcgccctcctcgtcggcgcccgcccccgcaccaagggcatggagcgcggc
gacctcctggaggccaacggcggcatcttcaagccgcagggcaaggccatcaacgaccac
gccgcggacgacatcaaggtcctcgtcgtcggcaacccggccaacaccaacgccctgatc
gcccaggccgccgctccggacgtaccggccgagcgcttcaccgcgatgacccgcctagac
cacaaccgcgccctgacccagctcgcgaagaagaccggctcgacggtcgccgacatcaag
cgcctgaccatctggggcaaccactcggccacccagtacccggacatcttccacgccacc
gtcgcgggcaagaacgccgccgagaccgtcaacgacgagaagtggctggccgacgagttc
atcccgaccgtcgccaagcgcggtgccgccatcatcgaggcccgcggcgcctcctcggcc
gcctccgccgccaacgccgccatcgaccacgtgtacacctgggtcaacggcactgccgag
ggcgactggacctccatgggcatcccgtcggacggctcctacggcgtccccgagggcatc
atctcctccttcccggtcaccacgaaggacggctcgtacgagatcgtccagggcctggac
atcaacgagttctcccgcgcccgcatcgacgcctccgtcaaggagctgtcggaggagcgc
gaggcggtgcgcggtctcggcctcatctga

DBGET integrated database retrieval system