KEGG   Streptomyces coelicolor: SCO4914Help
Entry
SCO4914           CDS       T00085                                 

Gene name
SCK13.06c
Definition
(RefSeq) 2-deoxyribose-5-phosphate aldolase
  KO
K01619  deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
sco  Streptomyces coelicolor
Pathway
sco00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO4914 (SCK13.06c)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.4  deoxyribose-phosphate aldolase
     SCO4914 (SCK13.06c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC
Motif
Other DBs
NCBI-GeneID: 1100355
NCBI-ProteinID: NP_629067
Kitasato: SCO4914
UniProt: Q9AD83
Position
complement(5347200..5348195)
Genome map
AA seq 331 aa AA seqDB search
MPTTAPAANGPAQGPANGPAHGFADVTASDSTLRRFLHGLPGVDTVGLEARAASLGTRSI
KTTAKAYALDLAISMVDLTTLEGADTPGKVRALGAKSVRPDPTDRTAPATAAVCVYPDMV
PTAREAVAGSGVKVASVATAFPAGRASLAVKLADVREAVAAGADEVDMVIDRGAFLAGNY
MKVYDEIAAVREACGTSARLKVIFETGELSTYDNIRRASWLGMLAGADFIKTSTGKVAVN
ATPANTLLMLEAVRDFRAQTGVQVGVKPAGGIRTAKDAIKFLVLVNETAGEDWLDNHWFR
FGASSLLNDLLMQRQKLATGRYSGPDYVTVD
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccactgcacccgccgcaaacggacccgcacagggccccgcaaacggacccgca
cacggattcgccgacgtcaccgcgtccgacagcaccctgcgccgcttcctccacggactg
cccggcgtcgacaccgtcggcctggaggcgcgcgccgcctccctcggcacccgatccatc
aagaccaccgcgaaggcgtacgccctggacctggccatctcgatggtcgacctgacgacg
ctggaaggcgcggacaccccgggcaaggtccgggcgctcggcgcgaagtcggtccgcccc
gacccgaccgaccgcacggccccggcgacggcggccgtctgcgtctaccccgacatggtg
cccaccgcgagggaagccgtcgccggctccggcgtgaaggtcgcctcggtcgccacggcg
ttcccggccggccgtgcctcgctggccgtcaagctggccgacgtgcgcgaggccgtggcg
gcgggcgcggacgaggtcgacatggtcatcgaccgcggcgcgttcctcgcggggaactac
atgaaggtgtacgacgagatcgccgccgtccgcgaggcctgcgggacgtccgcccgtctg
aaggtcatcttcgagaccggcgagctgtcgacgtacgacaacatccgccgcgccagctgg
ctcggcatgctggccggagcggacttcatcaagacgtccaccggcaaggtcgcggtcaac
gccacccccgccaacaccctcctgatgctggaggcggtccgcgacttccgcgcccagacc
ggcgtccaggtgggcgtgaagccggccggcggcatccggaccgcgaaggacgcgatcaag
ttcctggtcctggtcaacgagacggcgggcgaggactggctggacaaccactggttccgc
ttcggcgcctcctcgctcctcaacgacctgctgatgcagcgccagaagctggccacaggc
cgttactccggccccgactacgtgacggtggactga

DBGET integrated database retrieval system