KEGG   Streptomyces coelicolor: SCO4919Help
Entry
SCO4919           CDS       T00085                                 

Gene name
SCK13.11
Definition
(RefSeq) flavoprotein disulfide reductase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00020  Citrate cycle (TCA cycle)
sco00260  Glycine, serine and threonine metabolism
sco00280  Valine, leucine and isoleucine degradation
sco00620  Pyruvate metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco00640  Propanoate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sco_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO4919 (SCK13.11)
   00020 Citrate cycle (TCA cycle)
    SCO4919 (SCK13.11)
   00620 Pyruvate metabolism
    SCO4919 (SCK13.11)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO4919 (SCK13.11)
   00640 Propanoate metabolism
    SCO4919 (SCK13.11)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO4919 (SCK13.11)
   00280 Valine, leucine and isoleucine degradation
    SCO4919 (SCK13.11)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     SCO4919 (SCK13.11)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SCO4919 (SCK13.11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA AlaDh_PNT_C XdhC_C FAD_binding_2 FAD_oxidored K_oxygenase HI0933_like HTH_24 HTH_AsnC-type NAD_binding_9
Motif
Other DBs
NCBI-GeneID: 1100360
NCBI-ProteinID: NP_629072
Kitasato: SCO4919
UniProt: Q9EWF0
Position
5352587..5354014
Genome map
AA seq 475 aa AA seqDB search
MIIGGGPGGYEAALVAAQLGAEVTVVDCDGLGGASVLTDCVPSKTLIATAEVMTTFDSSY
EELGIIVADDTPPMEQAARVVGVDLGKVNRRVKRLALAQSHDITASVTRAGARVMRGRGR
LEGMQGLDGSRKVVVRAADGSEETLTADAVLIATGGHPRELADARPDGERILNWTQVYDL
EELPEELVVVGSGVTGAEFAGAYQALGSRVTLVSSRDRVLPGEDPDAAAVLEDVFRRRGM
NVMSRSRAQSVKRVGDRVEVTLSDGRVIGGSHCLMAVGAIPNTEGMGLEEAGVRLKDSGH
IKTDRVSRTSAPGVYAAGDVTGVFALASVAAMQGRIAMYHFLGDAVTPLNLKTVSANVFT
DPEIATVGYSQADVDAGKIDARVVKLPLLRNPRAKMQGIRDGFVKIFCRPGTEIVVGGVV
VAPRASELIHPISIAVDNNLTVEQIANAFTVYPSLSGSIAEVARQLHTRKAGGEQ
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
gtgatcattggcggcggacccggcggatacgaagcggcgctggtggccgctcaactcggc
gcggaggtgaccgtcgtcgactgcgacggtctgggcggggcgtcggtgctgaccgactgc
gtgccgtccaagaccctcatcgccacggctgaggtgatgaccaccttcgactcctcgtac
gaggagctggggatcatcgtcgccgacgacactccgcccatggagcaggccgcccgggtg
gtgggcgtggacctgggcaaggtcaaccgtcgggtgaagcggctcgcgctggcgcagtcg
cacgacatcaccgcctccgtgacccgtgcgggtgcgcgggtgatgcgcgggcgcgggcgg
ctggagggcatgcaggggctcgacgggtcgcggaaggtcgtggtgcgggccgccgacggg
agtgaggagacgctgaccgccgacgcggtgctcattgccacgggcgggcacccgcgggag
ctggcggacgcgcggcccgacggggagcggatcctgaactggacccaggtctacgacctg
gaggagctgcccgaggaactcgtcgtggtgggctccggtgtgaccggcgccgagttcgcc
ggcgcctatcaggcgctcgggtcgcgggtcaccctggtgtcgtcgcgggaccgggtgctg
ccgggtgaggacccggatgcggcggcggttctggaagacgtgttccggcggcgtgggatg
aacgtcatgtcgcggtcgcgggcccagtccgtcaagcgggtgggggaccgggtcgaggtg
acgctgtcggacgggcgggtcatcggcgggtcgcactgtctgatggccgtcggcgccatt
cccaacacggaggggatggggctggaggaggcgggggtccggctcaaggactccgggcac
atcaagaccgaccgggtctcgcggacctcggcccccggtgtgtacgccgccggtgacgtc
accggcgtcttcgcgctcgcctcggtggcggcgatgcaggggcggatcgccatgtaccac
ttcctcggcgacgccgtgactccgctgaacctgaagaccgtctccgccaacgtcttcacc
gatcccgagatcgccacggtcgggtactcgcaggccgacgtggacgccggcaagatcgac
gcccgggtggtgaagctgccgctgctgcgcaacccgcgcgccaagatgcagggcatccgg
gacggcttcgtcaagatcttctgccggcccggtaccgagatcgtggtggggggtgtcgtg
gtggcgccgcgtgcttcggagctcatccatcccatctccatcgccgtcgacaacaacctg
acggtcgagcagatcgccaacgccttcaccgtgtatccctccctgtcgggctcgatcgcc
gaggtggcgcggcagctgcacacgcggaaggccggcggggagcagtag

DBGET integrated database retrieval system