KEGG   Streptomyces coelicolor: SCO4921Help
Entry
SCO4921           CDS       T00085                                 

Gene name
accA2, SCK13.13c
Definition
(RefSeq) acyl-CoA carboxylase complex A subunit
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
sco  Streptomyces coelicolor
Pathway
sco00061  Fatty acid biosynthesis
sco00280  Valine, leucine and isoleucine degradation
sco00620  Pyruvate metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco00640  Propanoate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01212  Fatty acid metabolism
Module
sco_M00082  Fatty acid biosynthesis, initiation
sco_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO4921 (accA2)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO4921 (accA2)
   00640 Propanoate metabolism
    SCO4921 (accA2)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SCO4921 (accA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO4921 (accA2)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SCO4921 (accA2)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SCO4921 (accA2)
    6.4.1.3  propionyl-CoA carboxylase
     SCO4921 (accA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATP-grasp Biotin_lipoyl_2 ATPgrasp_Ter HlyD_D23 Dala_Dala_lig_C HlyD_3 RnfC_N
Motif
Other DBs
NCBI-GeneID: 1100362
NCBI-ProteinID: NP_629074
Kitasato: SCO4921
UniProt: Q9EWV4
Position
complement(5355283..5357055)
Genome map
AA seq 590 aa AA seqDB search
MRKVLIANRGEIAVRVARACRDAGIASVAVYADPDRDALHVRAADEAFALGGDTPATSYL
DIAKVLKAARESGADAIHPGYGFLSENAEFAQAVLDAGLIWIGPPPHAIRDLGDKVAARH
IAQRAGAPLVAGTPDPVSGADEVVAFAKEHGLPIAIKAAFGGGGRGLKVARTLEEVPELY
DSAVREAVAAFGRGECFVERYLDKPRHVETQCLADTHGNVVVVSTRDCSLQRRHQKLVEE
APAPFLSEAQTEQLYSSSKAILKEAGYVGAGTVEFLVGMDGTISFLEVNTRLQVEHPVTE
EVAGIDLVREMFRIADGEELGYDDPALRGHSFEFRINGEDPGRGFLPAPGTVTLFDAPTG
PGVRLDAGVESGSVIGPAWDSLLAKLIVTGRTRAEALQRAARALDEFTVEGMATAIPFHR
TVVRDPAFAPELTGSTDPFTVHTRWIETEFVNEIKPFTTPADTETDEESGRETVVVEVGG
KRLEVSLPSSLGMSLARTGLAAGARPKRRAAKKSGPAASGDTLASPMQGTIVKIAVEEGQ
EVQEGDLIVVLEAMKMEQPLNAHRSGTIKGLTAEVGASLTSGAAICEIKD
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaaggtgctcatcgccaatcgtggcgaaatcgctgtccgcgtggcccgggcctgc
cgggacgccgggatcgcgagcgtggccgtctacgcggatccggaccgggacgcgttgcac
gtccgtgccgctgatgaggcgttcgccctgggtggtgacacccccgcgaccagctatctg
gacatcgccaaggtcctcaaagccgcgcgcgagtcgggcgcggacgccatccaccccggc
tacgggttcctctcggagaacgccgagttcgcgcaggcggtcctggacgccggcctgatc
tggatcggcccgcccccgcacgccatccgcgacctgggcgacaaggtcgccgcccgccac
atcgcccagcgggccggcgcccccctggtcgccggcacccccgaccccgtctccggcgcg
gacgaggtcgtcgccttcgccaaggagcacggcctgcccatcgccatcaaggccgccttc
ggcggcggcgggcgcggcctcaaggtcgcccgcaccctcgaagaggtgccggagctgtac
gactccgccgtccgcgaggccgtggccgccttcggccgcggggagtgcttcgtcgagcgc
tacctcgacaagccccgccacgtggagacccagtgcctggccgacacccacggcaacgtg
gtcgtcgtctccacccgcgactgctccctccagcgccgccaccaaaagctcgtcgaggag
gcccccgcgcccttcctctccgaggcccagacggagcagctgtactcatcctccaaggcc
atcctgaaggaggccggctacgtcggcgccggcaccgtggagttcctcgtcggcatggac
ggcacgatctccttcctggaggtcaacacccgcctccaggtcgagcacccggtcaccgag
gaagtcgccggcatcgacctggtccgcgagatgttccgcatcgccgacggcgaggaactc
ggctacgacgaccccgccctgcgcggccactccttcgagttccgcatcaacggcgaggac
cccggccgcggcttcctgcccgcccccggcaccgtcaccctcttcgacgcgcccaccggc
cccggcgtccgcctggacgccggcgtcgagtccggctccgtcatcggccccgcctgggac
tccctcctcgccaaactgatcgtcaccggccgcacccgcgccgaggcactccagcgcgcg
gcccgcgccctggacgagttcaccgtcgagggcatggccaccgccatccccttccaccgc
acggtcgtccgcgacccggccttcgcccccgaactcaccggctccacggaccccttcacc
gtccacacccggtggatcgagacggagttcgtcaacgagatcaagcccttcaccacgccc
gccgacaccgagacggacgaggagtcgggccgggagacggtcgtcgtcgaggtcggcggc
aagcgcctggaagtctccctcccctccagcctgggcatgtccctggcccgcaccggcctg
gccgccggggcccgccccaagcgccgcgcggccaagaagtccggccccgccgcctcgggc
gacaccctcgcctccccgatgcagggcacgatcgtcaagatcgccgtcgaggagggccag
gaagtccaggaaggcgacctcatcgtcgtactcgaggcgatgaagatggaacagcccctc
aacgcccacaggtccggcaccatcaagggcctcaccgccgaggtcggcgcctccctcacc
tccggcgccgccatctgcgagatcaaggactga

DBGET integrated database retrieval system