KEGG   Streptomyces coelicolor: SCO4928Help
Entry
SCO4928           CDS       T00085                                 

Gene name
cya, SCK13.20
Definition
(RefSeq) adenylate cyclase
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO4928 (cya)
Enzymes [BR:sco01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     SCO4928 (cya)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc Ad_Cy_reg
Motif
Other DBs
NCBI-GeneID: 1100369
NCBI-ProteinID: NP_629081
Kitasato: SCO4928
UniProt: P40135
Position
5361712..5362857
Genome map
AA seq 381 aa AA seqDB search
MTVDDTGSGADGDGRVDPEPAPDSADPGEDPLALRLEGLILGAERRYTPFQAARSAGVSM
ELASRFWRAMGFADIGQAKALTEADVLALRRLAGLVEAGLLSEAMAVQVARSTGQTTARL
AEWQIDSFLEGLTEPPEPGMTRTEVTYPIVELLLPELQEFLVYVWRRQLAASAGRVIQAG
DDEEMVDRRLAVGFADLVGFTRLTRRMEEEELGELVEAFETTSADLVAARGGRLVKTLGD
EVLYAADDAGTAAEIALLLVETMAHDETMPELRVGIAFGTVTTRMGDVFGTTVNLASRLT
SIAPKDAVLVDTAFAEELIRTRDAPASEAAAAEEAAAAEKEGEEPPVYRFALQPMWQRPV
RGLGVVEPWLLTRRDGGGGEA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtcgacgacaccggctccggcgcggacggggacggccgggtggaccccgagccc
gccccggactccgccgatcccggcgaggacccgctcgcgctgcgcctcgaggggctcatc
ctgggtgccgagcgccgctacacccccttccaggccgcccgcagcgcgggcgtctccatg
gaactggcctcccgcttctggcgggccatgggcttcgccgacatcggccaggccaaggcg
ctcaccgaggccgacgtcctcgccctcaggcgactggccggtctggtggaggcgggactg
ctcagcgaggcgatggccgtccaggtcgcccggtccacgggacagaccaccgcccggttg
gccgagtggcagatcgactccttcctggagggcctgaccgagcccccggagccggggatg
acgcgcaccgaggtgacgtaccccatcgtcgaactgctcctgcccgagctgcaggagttc
ctcgtgtacgtctggcggcgccagctcgccgcctcggccggccgcgtcatccaggccggg
gacgacgaggagatggtggaccggcggctcgcggtgggcttcgcggacctggtcggcttc
actcggctgacccggcggatggaggaggaggagctcggcgagctggtcgaggccttcgag
accacctccgccgacctggtggccgcgcgcggcggacggctggtcaagaccctcggcgac
gaggtgctctacgccgccgacgatgccggtacggccgccgagatcgcgctgctcctcgtc
gagacgatggcccacgacgagaccatgccggaactgcgcgtcggcatcgccttcggcacg
gtcaccacccggatgggcgacgtcttcggcaccaccgtcaacctggcctcccggctcacc
tcgatagcccccaaggacgcggtcctcgtcgacaccgccttcgcggaggagctgatccgc
acccgggacgcccccgcctcggaggcggcggcagcggaggaggccgccgcggcggagaag
gagggcgaggagccgccggtgtaccgcttcgcgctccagccgatgtggcagcggccggtg
cgcggcctcggcgtggtcgagccgtggctgctcacccgccgggacggcggcggcggggag
gcgtag

DBGET integrated database retrieval system