KEGG   Streptomyces coelicolor: SCO4932Help
Entry
SCO4932           CDS       T00085                                 

Gene name
hutH
Definition
(RefSeq) histidine ammonia-lyase
  KO
K01745  histidine ammonia-lyase [EC:4.3.1.3]
Organism
sco  Streptomyces coelicolor
Pathway
sco00340  Histidine metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SCO4932 (hutH)
Enzymes [BR:sco01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.3  histidine ammonia-lyase
     SCO4932 (hutH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_aromatic
Motif
Other DBs
NCBI-GeneID: 1100373
NCBI-ProteinID: NP_629085
Kitasato: SCO4932
UniProt: Q9EWW1
Position
5365963..5367501
Genome map
AA seq 512 aa AA seqDB search
MHTVVVGTSGVTASDVLAVARAGARIELSEEAVAALAAARSVVDALAAKPDPVYGVSTGF
GALATRHISPELRGRLQRNIVRSHAAGMGPRVEREVVRALMFLRLKTVCSGRTGVRPEVA
QTMADVLNAGITPVVHEYGSLGCSGDLAPLSHCALTLMGEGDAEGPDGTVRPAGELLAAH
GIAPVELREKEGLALLNGTDGMLGMLVMALADLDTLYKSADITAALTMEALLGTDRVLAP
ELHAIRPHPGQAASAANMAAVLKGSGLTGHHQDDAPRVQDAYSVRCAPQVAGAGRDTMAH
AGLVAERELAAAVDNPVVLPDGRVESNGNFHGAPVAYVLDFLAVAVADLGSIAERRTDRL
LDKNRSHGLPPFLADDAGVDSGLMIAQYTQAALVGELKRLAVPASADSIPSSAMQEDHVS
MGWSAARKLRTAVDNLARVIAVELYAATRAIQLREGLTPAPASQAVVEAVRAAGVEGPGP
DRHLAPDLAAADAFVRAGHLVAAAESVTGPLR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgcacactgtggtggtggggacgtcgggggtcaccgcgtccgacgttctcgccgtggcg
cgcgcgggcgcccggatcgagctttccgaggaggcggtggcggccctcgccgcggcccgc
tccgtcgtggacgcgctggccgccaagccggaccccgtctacggcgtgagcaccggcttc
ggcgccctggcgacccggcacatcagccccgagctgcgcggccggctccagcgcaacatc
gtccgctcgcacgccgccgggatgggcccgcgcgtcgagcgcgaggtggtccgcgcactg
atgttcctgcggctgaagaccgtctgctccggtcgcaccggcgtccgcccggaggtcgcg
cagaccatggccgacgtgctcaacgccgggatcaccccggtcgtgcacgagtacggctct
ctcggctgctccggtgacctcgccccgctctcccactgcgcgctgaccctcatgggcgag
ggcgacgccgagggccccgacggcaccgtgcggcccgccggcgagctgctcgccgcgcac
gggatcgcccccgtcgagctgcgcgagaaggagggcctcgccctcctcaacggcaccgac
ggcatgctcggcatgctggtcatggccctcgccgacctcgacaccctctacaagtcggcc
gacatcaccgccgcgctgaccatggaggccctgctcggcaccgaccgcgtgctcgccccc
gagctgcacgccatccgcccgcaccccgggcaggccgccagcgccgccaacatggccgcc
gtgctcaagggctccggcctgaccggccaccaccaggacgacgccccccgcgtccaggac
gcctactcggtgcgctgtgccccgcaggtcgccggtgcgggacgcgacaccatggcgcac
gccggtctcgtcgccgagcgggagctggcggcggccgtcgacaacccggtggtcctgccc
gacggacgcgtcgagtccaacggcaacttccacggcgccccggtcgcctacgtcctggac
ttcctcgccgtcgccgtcgccgacctcggctccatcgccgagcgccgcaccgaccggctc
ctggacaagaaccgcagccacggcctgccgccgttcctcgccgacgacgcgggcgtcgac
tccggcctgatgatcgcccagtacacgcaggccgccctggtcggcgagctgaagcggctc
gccgtaccggcctcggcggactccatcccgtcctccgcgatgcaggaggaccacgtgtcg
atgggctggtcggcggcgcgcaagctgcgcacggccgtcgacaacctggcgcgcgtgatc
gccgtcgagctgtacgccgccacgcgcgcgatccagctccgcgagggactgaccccggcg
cccgcgtcgcaggccgtcgtcgaggccgtacgggcggccggtgtggagggtccgggaccg
gaccgccacctggcgcccgacctcgccgcggcggacgcgttcgtgcgcgccgggcacctg
gtcgcggccgcggagagtgtcacggggccgctgcgctag

DBGET integrated database retrieval system