KEGG   Streptomyces coelicolor: SCO4945Help
Entry
SCO4945           CDS       T00085                                 

Gene name
2SCK31.05
Definition
(RefSeq) dehydrogenase
  KO
K13979  uncharacterized zinc-type alcohol dehydrogenase-like protein [EC:1.-.-.-]
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCO4945 (2SCK31.05)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     SCO4945 (2SCK31.05)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 NAD_binding_7 Oxidored_nitro ELFV_dehydrog
Motif
Other DBs
NCBI-GeneID: 1100386
NCBI-ProteinID: NP_629097
Kitasato: SCO4945
UniProt: Q9EWF1
Position
5378899..5379939
Genome map
AA seq 346 aa AA seqDB search
MTTVAAYAAPAAKAPLERTTIERREVREHDVLIDIKFAGICHSDIHQAREGWGEAIFPMV
PGHEIAGIVSEVGPGVTRFKVGDRVGVGCMVDSCRECENCKAGREQYCTSGNTGTYNAVG
RDGEVTYGGYSEKVVVDENFVLGIPEGIALDEAAPLLCAGITTYSPLKRWNAGPGKKVAV
VGLGGLGHMAVKLAHALGAEVTVLSQSLRKKDDGLKLGADHYYATSDPATFEELSGTFDL
IVSTVSAPLDLGAYLGLLKTEGTLANVGAPEEPVSLNLFALLGGGKSLSGSMIGGIAETQ
EMLDFCAEHGIGAEIELIAASEINEAYERVLSSDVRYRFVIDTATI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgtcgccgcgtacgcagcacccgccgccaaggcgccgctggagcgcaccacc
atcgagcggcgcgaggtgcgtgaacacgacgtcctgatcgacatcaagttcgccggcatc
tgccactccgacatccaccaggcccgcgagggctggggcgaggccatcttcccgatggtc
cccggccacgagatcgcgggcatcgtgtccgaggtcggccccggcgtcaccaggttcaag
gtcggcgaccgggtgggcgtcggctgcatggtcgactcctgccgcgagtgcgagaactgc
aaggccggccgggagcagtactgcaccagcggcaacaccggcacgtacaacgccgtcggc
agggacggcgaggtcacctacggcggctactccgagaaggtcgtcgtcgacgagaacttc
gtcctcggcatccccgagggcatcgccctggacgaggccgcccccctgctgtgcgccggc
atcaccacctactccccgctcaagcgctggaacgcgggtcccggcaagaaggtcgccgtc
gtcggcctgggcggcctcggtcacatggccgtcaagctcgcgcacgccctgggcgccgag
gtgaccgtgctgtcgcagtccctgcgcaagaaggacgacggcctgaagctgggcgccgac
cactactacgccaccagcgacccggccaccttcgaggagctgtccggcaccttcgacctg
atcgtctccacggtctcggccccgctcgacctcggcgcctacctggggctgctgaagacg
gagggcacgctggccaacgtcggcgcccccgaggagccggtctccctcaacctgttcgcg
ctgctcggcgggggcaagtccctctccggctccatgatcggcggtatcgccgagacccag
gagatgctggacttctgcgcggagcacggcatcggtgccgagatcgagctgatcgccgcc
tccgagatcaacgaggcctacgagcgcgtcctgtccagcgacgtgcgctaccgcttcgtg
atcgacaccgcgacgatctga

DBGET integrated database retrieval system