KEGG   Streptomyces coelicolor: SCO4958Help
Entry
SCO4958           CDS       T00085                                 

Gene name
2SCK31.18, metB
Definition
(RefSeq) cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
sco  Streptomyces coelicolor
Pathway
sco00270  Cysteine and methionine metabolism
sco00450  Selenocompound metabolism
sco00920  Sulfur metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SCO4958 (2SCK31.18)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO4958 (2SCK31.18)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCO4958 (2SCK31.18)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     SCO4958 (2SCK31.18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 1100399
NCBI-ProteinID: NP_629110
Kitasato: SCO4958
UniProt: Q9EWF9
Position
5393841..5395001
Genome map
AA seq 386 aa AA seqDB search
MPMSDRHISQHFETLAIHAGNTADPLTGAVVPPIYQVSTYKQDGVGGLRGGYEYSRSANP
TRTALEENLAALEGGRRGLAFASGLAAEDCLLRTLLRPGDHVVIPNDAYGGTFRLFAKVA
TRWGVEWSVADTSDAAAVRAALTPKTKAVWVETPSNPLLGITDIAQVAQVARDAGARLVV
DNTFATPYLQQPLALGADVVVHSLTKYMGGHSDVVGGALIVGDQELGEELAFHQNAMGAV
AGPFDSWLVLRGTKTLAVRMDRHSENATKVADMLSRHARVTSVLYPGLPEHPGHEVAAKQ
MKAFGGMVSFRVEGGEQAAVEVCNRAKVFTLGESLGGVESLIEHPGRMTHASAAGSALEV
PADLVRLSVGIENADDLLADLQQALG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgcccatgagcgacaggcacatcagtcagcacttcgagacgctcgcgatccacgcgggc
aacaccgccgatcccctgacgggcgcggtcgtcccgccgatctatcaggtgtcgacctac
aagcaggacggcgtcggcggattgcgcggcggctacgagtacagccgcagcgccaacccg
acccgtaccgcgctggaggagaacctcgccgccctggagggcggccgccgcggcctcgcg
ttcgcgtccggactggcggccgaggactgcctgttgcgtacgctgctgcgccccggcgac
cacgtggtgatcccgaacgacgcgtacggcggcaccttccgcctcttcgccaaggtcgcc
acccggtggggtgtggagtggtccgtggccgacacgagcgacgccgccgccgtgcgggcc
gccctcaccccgaagaccaaggcggtgtgggtggagacgccctccaacccgctgctcggc
atcaccgacatcgcgcaggtcgcccaggtcgcccgggacgccggcgcccggctcgtcgtc
gacaacaccttcgccaccccgtacctccagcagccgctggccctcggcgccgacgtcgtc
gtgcactcgctgaccaagtacatgggcgggcactcggacgtcgtgggcggcgcgctgatc
gtgggcgaccaggagctgggcgaggagctggcgttccaccagaacgcgatgggcgcggtc
gccggacccttcgactcctggctggtgctgcgcggcaccaagaccctcgccgtgcgcatg
gaccggcacagcgagaacgcgaccaaggtcgccgacatgctctcccggcacgcgcgcgtg
acgagcgtgctgtacccggggctgcccgagcacccggggcacgaggtcgccgccaagcag
atgaaggcgttcggcggcatggtgtcgttccgcgtcgagggcggcgagcaggccgccgtc
gaggtgtgcaaccgcgcgaaggtcttcacgctcggcgagtccctcggcggcgtcgagtcg
ctgatcgagcacccgggccggatgacgcacgcctccgcggcgggctcggccctggaggtg
cccgccgacctggtgcggctgtcggtcggcatcgagaacgccgacgacctgctggccgac
ctccagcaggcgctgggctag

DBGET integrated database retrieval system