KEGG   Streptomyces coelicolor: SCO4962Help
Entry
SCO4962           CDS       T00085                                 

Gene name
2SCK31.22
Definition
(RefSeq) threonine dehydratase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00290  Valine, leucine and isoleucine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO4962 (2SCK31.22)
   00290 Valine, leucine and isoleucine biosynthesis
    SCO4962 (2SCK31.22)
Enzymes [BR:sco01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     SCO4962 (2SCK31.22)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ACT_6 ACT ACT_4
Motif
Other DBs
NCBI-GeneID: 1100403
NCBI-ProteinID: NP_629114
Kitasato: SCO4962
UniProt: Q9EWG3
Position
5396674..5397903
Genome map
AA seq 409 aa AA seqDB search
MSYSTASCVAPVTLDDVRGAQKMLSGVARVTAMEGSRHLSQLVGSPVHLKCENLQRTGSF
KLRGAYVRIAGLLPEQRAAGVVAASAGNHAQGVALASSLLGVRSTVFMPQGAPLPKISAT
RDYGAEVRLHGQVVDETLAAAQEYAERTGAVFIHPFDHPDVIAGQGTVGLEILEQCPEVR
TVVVGIGGGGLAAGIAVAVKALRPDVRIVGVQAEGAAAYPPSLAAGRPVAVQNPATMADG
IKVGRPGDVPFGIVGELVDEVRTVSEDALSTALLLCLERAKLVVEPAGASPVAALLSEPD
AFEGPVVAVLSGGNVDPVLMQGVLRHGMAAQGRYLAVRLRLTDRPGALATLLGVLSVVDA
NVLDVSHVRTHPRLGLTEAEVELHLETKGPEHCTEVGRVLREAGYTVIA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgagctacagcacagcgtcctgcgtcgctcccgtcaccctcgacgacgtgcgcggagcc
cagaagatgctctcgggcgtggcgcgggtgacggccatggagggcagcaggcacctctcc
cagctggtcggctcgccggtgcacctcaagtgcgagaacctccagcggacgggctcgttc
aagctgcgcggcgcctacgtgcggatcgccgggctgctccccgagcagcgggccgcgggc
gtggtcgcggcgagcgcgggcaaccacgcgcagggcgtcgcgctggcctcgtcgctgctc
ggtgtgcgctcgacggtgttcatgccgcagggggcgccgctgcccaagatcagcgcgacc
cgggactacggcgccgaggtgcggctgcacggccaggtggtggacgagacgctggccgcc
gcgcaggagtacgcggagcggaccggcgcggtcttcatccaccccttcgaccaccccgac
gtcatcgcgggccagggcacggtcgggctggagatcctggagcagtgccccgaggtgcgg
accgtcgtcgtcggcatcggcgggggcggactggcggccgggatcgcggtcgcggtgaag
gcgctgcggccggacgtgcggatcgtcggcgtgcaggcggagggcgcggccgcctacccg
ccctcgctggccgccggacgcccggtcgccgtgcagaacccggcgacgatggccgacggg
atcaaggtggggcggcccggcgacgtgccgttcgggatcgtcggcgaactggtggacgag
gtccgcacggtctccgaggacgcgctgtcgaccgcgctgctgctgtgtctggagcgggcc
aagctggtcgtggagccggccggagcgagcccggtggcggcgctgctgagcgagccggac
gccttcgagggaccggtcgtcgcggtcctgtccggcggcaacgtggacccggtgctgatg
cagggtgtgctgcggcacggcatggccgcgcagggccgctacctggcggtccggctgcgg
ctgacggaccggcccggcgccctggccacgctgctcggggtgttgtcagtggtcgacgct
aacgtcctcgatgtgagccacgtccgaacccatccgcggctcgggctcacggaggcggag
gtcgagctgcacctggagacgaagggcccggagcactgcaccgaggtcggccgcgtgctg
cgggaagcgggatacacggtcatcgcctga

DBGET integrated database retrieval system