KEGG   Streptomyces coelicolor: SCO4984Help
Entry
SCO4984           CDS       T00085                                 

Gene name
2SCK36.07c
Definition
(RefSeq) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00220  Arginine biosynthesis
sco00250  Alanine, aspartate and glutamate metabolism
sco00290  Valine, leucine and isoleucine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO4984 (2SCK36.07c)
   00290 Valine, leucine and isoleucine biosynthesis
    SCO4984 (2SCK36.07c)
   00220 Arginine biosynthesis
    SCO4984 (2SCK36.07c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sco01007]
    SCO4984 (2SCK36.07c)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SCO4984 (2SCK36.07c)
    2.6.1.66  valine---pyruvate transaminase
     SCO4984 (2SCK36.07c)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class I
   SCO4984 (2SCK36.07c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-GeneID: 1100425
NCBI-ProteinID: NP_629136
Kitasato: SCO4984
UniProt: Q93JL0
Position
complement(5421700..5422911)
Genome map
AA seq 403 aa AA seqDB search
MQVIQSTKLANVCYEIRGPVLEEAMRLEAAGHRILKLNTGNPAAFGFECPPEILEDILRN
VSTAHGYGDAKGLLAARRAVVMHNQTLGIETDVEHVFIGNGVSELIVMAMQGLLDDGDEV
LVPAPDYPLWTAAVSLSGGTAVHYRCDEQSDWMPDLADVERKITDRTKALVIINPNNPTG
AVYDDAMLRGLTDIARRHNLLVCSDEIYDKILYDDATHTPTAAIAPDLLTLTFNGMSKAY
RVAGYRVGWMSISGPRAHAESYIEGLTILANMRLCANMPGQHGVVAALSGRQTINELVLP
GGRLREQRDAAHEALTSIPGVTCVKPKGALYLFPRLDPKVFKIKDDRRMVLDLLRQEKIM
VVQGTGFNWPEPDHFRVVTLPTAADLREAVDRIGNFLDGYSQP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgatccagtcgaccaagctcgccaacgtctgttacgagatccggggcccggtg
ctcgaggaggcgatgcggctggaggcggccgggcaccgcatcctgaagctgaacaccggc
aatccggcagccttcggcttcgagtgcccgccggagattttggaggacatcctccgcaac
gtctccacggcgcacggctacggcgacgcgaagggcctgctggcggcgcgccgggcggtc
gtcatgcacaaccagaccctcggcatcgagacggacgtcgagcacgtcttcatcggcaac
ggcgtctccgagctgatcgtgatggcgatgcagggcctgctcgacgacggcgacgaggtc
ctcgtcccggcccccgactacccgctgtggacggccgccgtctcactgtccggcggtacg
gcggtgcactaccgctgcgacgagcagtccgactggatgcccgacctcgcggacgtggag
cggaagatcaccgaccgcaccaaggccctggtgatcatcaatccgaacaacccgacgggc
gcggtctacgacgacgcgatgctgcgcggactgacggacatcgcccgccggcacaacctg
ctggtctgctcggacgagatctacgacaagatcctctacgacgacgccacccacaccccg
accgccgcgatcgcccccgacctgctcaccctcaccttcaacggcatgtcgaaggcgtac
cgggtggccggttaccgggtcggctggatgtcgatctccgggccgcgcgcgcacgccgag
tcctacatcgagggcctgacgatcctggcgaacatgcgcctgtgcgccaacatgccgggc
cagcacggcgtggtcgcggcgctcagcgggcggcagaccatcaacgagctggtgctgccg
ggcgggcggctgcgcgagcagcgcgacgccgcccacgaggcactgaccagcattcccggc
gtgacctgcgtgaagccgaagggtgcgctgtacctcttcccgcggctcgaccccaaggtc
ttcaagatcaaggacgaccggcggatggtcctggacctgctgcgccaggagaagatcatg
gtcgtccagggcaccggcttcaactggcccgagcccgaccacttccgggtggtgaccctg
ccgacggccgcggacctgcgcgaggcggtggaccggatcgggaacttcctggacgggtac
agccagccctga

DBGET integrated database retrieval system