KEGG   Streptomyces coelicolor: SCO5042Help
Entry
SCO5042           CDS       T00085                                 

Gene name
fumC
Definition
(RefSeq) fumarate hydratase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00020  Citrate cycle (TCA cycle)
sco00620  Pyruvate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO5042 (fumC)
   00620 Pyruvate metabolism
    SCO5042 (fumC)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     SCO5042 (fumC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 FumaraseC_C MCM_lid
Motif
Other DBs
NCBI-GeneID: 1100483
NCBI-ProteinID: NP_629194
Kitasato: SCO5042
UniProt: Q9FBN6
Position
complement(5480624..5482009)
Genome map
AA seq 461 aa AA seqDB search
MSEYRIEHDSMGEVRVPADAKWRAQTQRAVENFPVSGQRIERAHIEALARIKSAAAKVNA
ELGVLDEDVAGAIQEAAGEVAEGKWDEHFPVDVFQTGSGTSSNMNTNEVVATLATERLGR
DVHPNDHVNASQSSNDVFPSSIHIAATAAVTRDLIPALDHLAGALERKAGEFADVVKSGR
THLMDATPVTLGQEFGGYAAQVRYGIERLQASLPRLAELPLGGTAVGTGINTPPGFSAAV
IEEVARATGLPLTEARDHFEAQGARDGIVETSGQLRTIGVGLTKIANDLRWMASGPRTGL
AEISLPDLQPGSSIMPGKVNPVIPEAVLMVAAQVTGNDATVAAAGAAGNFELNVMLPVIA
KNVLESVRLLANVSRLLADRTVDGIVAHPERAREYAESSPSVVTPLNKYLGYEEAAKVAK
RALAERKTIRQTVLEGGYVERGDLTREQLDQALDVLRMTRP
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaataccgcatcgagcacgactccatgggcgaggtccgcgtccccgcggacgcc
aagtggcgcgcccagacccagcgcgccgtcgagaacttccccgtctccgggcagcgcatc
gagcgcgcgcacatcgaggcgctggcgcggatcaagagcgcggcggcgaaggtcaacgcc
gagctgggagtgctcgacgaggacgtcgccggcgcgatccaggaggcggccggtgaggtg
gccgaggggaagtgggacgagcacttccccgtcgacgtgttccagaccgggtccgggacc
tcgtccaacatgaacaccaacgaggtcgtcgccaccctggcgactgaacggctcggccgc
gacgtgcatcccaacgaccacgtcaacgcctcccagtcgtccaacgacgtcttcccgtcc
tcgatccacatcgccgccaccgccgccgtcacccgcgacctgatcccggccctggaccat
ctcgccggcgccctggagcgcaaggccggggagttcgccgacgtggtgaagtccgggcgt
acgcacctcatggacgccacgcccgtcaccctgggccaggagttcggcggttacgcggcc
caggtgcggtacggcatcgagcggcttcaggcctcactgccccggctcgccgagctgccg
ctgggcggcaccgcggtcggcaccggcatcaacaccccgcccggcttctccgccgccgtc
atcgaggaggtggcccgcgcgacggggctgccgctgaccgaggcgcgcgaccacttcgag
gcgcagggcgcccgggacggcatcgtcgagaccagcgggcagctgcggaccatcggcgtc
gggctcacgaagatcgccaacgacctgcgctggatggcgtccggtccgcgcaccgggctc
gcggagatctcgctgcccgacctccagcccgggtcgtccatcatgcccggcaaggtcaac
ccggtgatccccgaggcggtcctcatggtcgccgcccaggtcaccggcaacgacgcgacg
gtcgccgcggcgggcgcggccggcaacttcgagctgaacgtgatgctgccggtcatcgcc
aagaacgtgctggagtcggtgcggctgctcgccaacgtctcccggctgctcgccgaccgc
accgtggacgggatcgtggcgcaccccgagcgggcccgcgagtacgccgagtcctcgccc
tccgtggtcacgccgctcaacaagtacctcgggtacgaggaggccgccaaggtcgccaag
agggcgctggccgagcggaagacgatccggcagaccgtgctggagggcggctacgtggaa
cgcggcgacctcacgcgggagcaactggaccaggccctggacgtgctgcggatgacccgc
ccgtga

DBGET integrated database retrieval system