KEGG   Streptomyces coelicolor: SCO5044Help
Entry
SCO5044           CDS       T00085                                 

Gene name
fumB, SCK7.17c
Definition
(RefSeq) fumarate hydratase class I
  KO
K01676  fumarate hydratase, class I [EC:4.2.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00020  Citrate cycle (TCA cycle)
sco00620  Pyruvate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO5044 (fumB)
   00620 Pyruvate metabolism
    SCO5044 (fumB)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     SCO5044 (fumB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fumerase Fumerase_C
Motif
Other DBs
NCBI-GeneID: 1100485
NCBI-ProteinID: NP_629196
Kitasato: SCO5044
UniProt: Q9FBN4
Position
complement(5483742..5485418)
Genome map
AA seq 558 aa AA seqDB search
MGEMPEFAYTDLLPQGEDTTPYRLVTAEGVATFEADGRTFLKVEPEALRKLAEEAVHDIQ
HYLRPAHLAQLRRIIDDPEASGNDKFVALDLLKNANIAAAGVLPMCQDTGTAIVMGKRGQ
NVLTEGGDEEALSRGIYDAYKNLNLRYSQMAPLTMWEEKNTGSNLPAQIELYATDGGAYK
FLFMAKGGGSANKSFLYQETKAVLNESSMMKFLEEKIRSLGTAACPPYHLAIVVGGTSAE
YALKTAKYASAHYLDEIPAEGSELGHGFRDKELEEKVFELTQKIGIGAQFGGKYFCHDVR
VVRLPRHGASCPVAIAVSCSADRQAVAKITAEGVFLEQLETDPARFLPETTDEHLEEEGD
VVKVDLNQPMDDILAELTRHPVKTRLSLTGPLVVARDIAHAKIKERLDAGEEMPQYLKDH
PVYYAGPAKTPEGYASGSFGPTTAGRMDSYVEQFQAAGGSKVMLAKGNRSKQVTDACDAH
GGFYLGSIGGPAARLAQDCIKKVEVVEYEELGMEAVWKIEVEDFPAFIVVDDKGNDFFQD
PAPAPTFTTIPVRGPGLA
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagatgcctgagttcgcgtacaccgatctgctcccccagggcgaggacaccact
ccgtaccggctggtgaccgccgagggtgtcgccaccttcgaggccgacgggcggaccttc
ctcaaggtggagccggaggccctgcgcaagctggccgaggaggccgttcacgacatccag
cactacctgcgcccggcgcacctggcacagctgcgccgcatcatcgacgacccggaggcg
tccggcaacgacaagttcgtcgccctggacctgctgaagaacgcgaacatcgcggctgcg
ggcgtgctgccgatgtgccaggacaccggcacggcgatcgtcatgggcaagcgcggccag
aacgtgctcaccgagggcggtgacgaggaggccctgagccggggcatctacgacgcgtac
aagaacctgaacctgcgctactcccagatggccccgctgaccatgtgggaggagaagaac
accggctccaacctccccgcccagatcgagctgtacgcgaccgacggcggcgcctacaag
ttcctcttcatggcgaagggcggcggctcggccaacaagtccttcctctaccaggagacg
aaggccgtcctgaacgagtcctccatgatgaagttcctggaggagaagatccgctcgctc
ggcacggccgcctgcccgccgtaccacctggcgatcgtggtcggcggcacgtcggccgag
tacgcgctgaagaccgcgaagtacgcctccgcgcactacctggacgagatcccggccgag
ggctcggagctcgggcacggcttccgggacaaggagctggaggagaaggtcttcgagctg
acccagaagatcggcatcggcgctcagttcggcggcaagtacttctgccacgacgtgcgc
gtggtgcggctgccccggcacggggcgtcctgcccggtcgccatcgcggtgtcctgctcg
gcggaccggcaggcggtcgcgaagatcaccgccgagggcgtcttcctggagcagctggag
accgacccggcgcggttcctgccggagaccacggacgagcatctggaggaggagggcgac
gtcgtcaaggtcgacctcaaccagccgatggacgacatcctcgccgagctgaccaggcac
ccggtcaagacccggctgtcgctgaccggtccgctggtggtggcccgcgacatcgcgcac
gccaagatcaaggagcggctggacgcgggcgaggagatgccgcagtacctgaaggaccac
ccggtgtactacgcgggccccgcgaagacgcccgagggctacgcctccgggtccttcggt
ccgaccaccgccgggcgcatggactcctacgtcgagcagttccaggcggcgggcggctcc
aaggtgatgctggccaagggcaaccggagcaagcaggtcaccgacgcgtgcgacgcgcac
ggcggcttctacctgggctcgatcggcgggcccgcggcgcggctcgcacaggactgcatc
aagaaggtcgaggtcgtcgagtacgaggagctcggcatggaggcggtctggaagatcgag
gtcgaggacttccccgcgttcatcgtggtggacgacaagggcaacgacttcttccaggac
ccggcgcccgcgccgacgttcacgacgattccggtacgggggccgggcctggcgtaa

DBGET integrated database retrieval system