KEGG   Streptomyces coelicolor: SCO5059Help
Entry
SCO5059           CDS       T00085                                 

Gene name
ppgK, SCBAC20F6.02
Definition
(RefSeq) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00520  Amino sugar and nucleotide sugar metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO5059 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO5059 (ppgK)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     SCO5059 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-GeneID: 1100500
NCBI-ProteinID: NP_629210
Kitasato: SCO5059
UniProt: Q9ADE8
Position
5499055..5499795
Genome map
AA seq 246 aa AA seqDB search
MQIFGVDIGGSGIKGAPVDLDRGDLAQERCKVLTPHPATPDGVADGVKQVVEHFGWTGRV
GLTFPGVVTGGATVRTAANVDKGWVDTDARALFAERLGGLDVTVVNDADAAGVAEMHFGA
GRGRKGTVVLLTFGTGIGSAVFTDGLLVPNTELGHLELDGHDAEKRASSKVKDDHDMSWE
HWAHRVQKYLAHVEMLFSPELFIIGGGVSRKSQKFLPHIKDVRAEIVPAQLQNNAGIVGA
AMHAAG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcttcggcgtggacatcggcggatccgggatcaagggcgcccctgtggacctc
gacaggggcgacctggcccaggagcgctgcaaggtgctgaccccgcacccggccaccccc
gacggcgtggccgacggggtcaagcaggtcgtcgagcacttcggctggaccggacgggtc
ggcctcaccttcccgggcgttgtgacgggcggcgcgacggtgcgcaccgcggccaacgtc
gacaagggctgggtcgacaccgacgcgcgggcgctgttcgccgagcggctgggcgggctc
gacgtgacggtcgtcaacgacgcggacgcggcgggcgtcgccgagatgcacttcggagcc
ggccgcggccgcaagggcacggtggtcctgctcaccttcggcaccggcatcggcagcgcg
gtgttcaccgacggcctcctggtccccaacaccgagctgggccacctggagctggacggt
cacgacgcggagaagcgcgcctccagcaaggtcaaggacgaccacgacatgtcgtgggag
cactgggcccaccgcgtccagaagtacctcgcgcacgtcgagatgctgttctcgccggag
ctcttcatcatcggcggcggggtcagccgcaagtcccagaagttcctgccccacatcaag
gacgtccgggccgagatcgtccccgcccagctgcagaacaacgcggggatcgtgggcgcg
gcgatgcacgcggccggctga

DBGET integrated database retrieval system