KEGG   Streptomyces coelicolor: SCO5077Help
Entry
SCO5077           CDS       T00085                                 

Gene name
actVA2, SCBAC28G1.03
Definition
(RefSeq) hypothetical protein
  KO
K05558  pyridoxamine 5'-phosphate oxidase family protein
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99988 Secondary metabolism
    SCO5077 (actVA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Putative_PNPOx Pyridox_ox_2 FMN_bind_2
Motif
Other DBs
NCBI-GeneID: 1100518
NCBI-ProteinID: NP_629227
Kitasato: SCO5077
UniProt: Q93IZ3
Position
5519497..5519892
Genome map
AA seq 131 aa AA seqDB search
MPFTPDELEYYASQNLGRLATVAPDGQPQANPVSFRVNTETGTIDIGGHNLTASKKFRNV
TKHDQVAFVVDDLISTQPWNVRGIEVRGRAEALTDAQPPHPYFGTAMIRIHPKRIITWGL
GGDAAQRGRDV
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcactcctgacgagctcgagtactacgcctcccagaacctcggccggctggcc
accgtggcgcccgacggccagccccaggccaacccggtctcgttccgcgtcaacaccgag
accggcacgatcgacatcggcgggcacaacctgaccgccagcaagaagttccgcaacgtc
accaagcacgaccaggtcgccttcgtcgtcgacgacctgatctccacgcagccgtggaac
gtacgcggtatcgaagtgcgcggccgggccgaggcgctgaccgacgcgcagccgccgcac
ccctacttcggtaccgcgatgatccgtatccaccccaagcgcatcatcacctggggcctc
ggcggcgacgccgcccagcgcggccgcgacgtctga

DBGET integrated database retrieval system