KEGG   Streptomyces coelicolor: SCO5086Help
Entry
SCO5086           CDS       T00085                                 

Gene name
actIII, SCBAC28G1.12c
Definition
(RefSeq) ketoacyl reductase
  KO
K12420  ketoreductase [EC:1.1.1.-]
Organism
sco  Streptomyces coelicolor
Pathway
sco00253  Tetracycline biosynthesis
sco01056  Biosynthesis of type II polyketide backbone
sco01130  Biosynthesis of antibiotics
Module
sco_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    SCO5086 (actIII)
   00253 Tetracycline biosynthesis
    SCO5086 (actIII)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sco01004]
    SCO5086 (actIII)
   01008 Polyketide biosynthesis proteins [BR:sco01008]
    SCO5086 (actIII)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SCO5086 (actIII)
Lipid biosynthesis proteins [BR:sco01004]
 Polyketide synthase
  Component type
   SCO5086 (actIII)
Polyketide biosynthesis proteins [BR:sco01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     SCO5086 (actIII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NmrA
Motif
Other DBs
NCBI-GeneID: 1100527
NCBI-ProteinID: NP_629236
Kitasato: SCO5086
UniProt: P16544
Structure
PDB: 

Position
complement(5528935..5529720)
Genome map
AA seq 261 aa AA seqDB search
MATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGR
TCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFR
VTKQVLKAGGMLERGTGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGI
TVNAVCPGFVETPMAASVREHYSDIWEVSTEEAFDRITARVPIGRYVQPSEVAEMVAYLI
GPGAAAVTAQALNVCGGLGNY
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcaggactccgaagtcgcactggtgacgggtgcgaccagcggaatcgggctg
gagatcgcccgcaggctcggtaaggaggggttgcgcgtgttcgtctgcgcgcgcggcgaa
gaaggactgcggacgacgctgaaggagttgcgggaggcgggcgtggaggcggacgggcgg
acctgcgacgtccgctcggtcccggagatcgaggctctcgtggcggcggtggtcgagcgt
tacggtccggtcgacgtgctggtgaacaacgcgggccggcccggcggcggcgccacggcc
gaactcgccgacgaactctggctcgatgtcgtggagaccaacctcaccggcgtgttccgg
gtgaccaaacaggtcctcaaggcgggcggcatgctcgaacggggcacgggccgaatcgtc
aacatcgcctcgaccggcggaaagcagggtgtggtgcacgccgcgccctactccgcctcg
aagcacggcgtggtcggcttcaccaaggcgctcggtctcgaactggcgaggaccggcatc
acggtgaacgccgtctgccccggattcgtcgagacgccgatggccgcgtccgtgcgcgag
cactactcggacatctgggaggtgtcgaccgaggaggccttcgaccggatcaccgcgcgc
gtgccgatcggccggtacgtgcagccgtccgaggtggcggagatggtggcgtacctgatc
gggcccggtgcggccgcggtcaccgcgcaggcgctgaacgtctgcggcgggctggggaac
tactga

DBGET integrated database retrieval system