KEGG   Streptomyces coelicolor: SCO5139Help
Entry
SCO5139           CDS       T00085                                 

Gene name
dapE, SCP8.02
Definition
(RefSeq) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sco  Streptomyces coelicolor
Pathway
sco00300  Lysine biosynthesis
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01230  Biosynthesis of amino acids
Module
sco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SCO5139 (dapE)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SCO5139 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 1100580
NCBI-ProteinID: NP_629287
Kitasato: SCO5139
UniProt: Q9FBL9
Position
5586476..5587555
Genome map
AA seq 359 aa AA seqDB search
MADTPLDLTLDAAELTARLVDFPSESGTEKPLADAIESALRTLPHLSVERYGNNLVARTG
LGRAERVILAGHIDTVPIAGNVPSRLDEDGVLWGCGTCDMKAGVAVQLRIAATVPAPNRD
LTFVFYDNEEVAAELNGLKHVAEAHPEWLEGDFAVLLEPSDGQVEGGCQGTLRVLLKTAG
ERAHSARSWMGSNAIHAAAPILARLAAYEPRYPVIDGLEYREGLNAVGITGGVAGNVIPD
ECVVTVNFRYAPDRSPEEALAHVREVFDGCGVTDFVVDDHSGAALPGLSHPAAAAFIEAV
GGTPQPKYGWTDVSRFSALGVPAVNYGPGNPHLAHKRDERVEVAKILAGEERLRSWLTA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggccgataccccgcttgacctcacgctggacgccgcggagcttaccgcgcggctcgtc
gacttcccgtccgagagcggcaccgagaagcccctggcggacgcgatcgagagcgccctg
cggaccctgccccacctgtcggtcgagcggtacggcaacaacctcgtcgcgcgcaccggc
ctgggccgcgcggagcgcgtgatcctggcgggccacatcgacaccgtgccgatcgccggc
aacgtcccgtcccggctggacgaggacggcgtcctgtgggggtgcggcacctgcgacatg
aaggcgggcgtcgcggtccagctgcgcatcgcggccaccgtccccgcccccaaccgcgac
ctgaccttcgtcttctacgacaacgaggaggtcgccgccgagctgaacggcctgaagcac
gtcgccgaggcgcaccccgagtggctggagggcgacttcgcggtgctcctcgaaccgtcc
gacggccaggtggagggcggctgccagggcaccctgcgggtgctgctgaagaccgcgggg
gagcgggcgcactcggcgcgctcctggatgggctccaacgccatccacgccgccgccccg
atcctcgcgcgcctcgcggcgtacgagccccgctacccggtcatcgacggcctggagtac
cgcgagggcctcaacgcggtcggcatcacgggcggcgtggccggcaacgtcatccccgac
gagtgcgtggtcaccgtcaacttccgctacgccccggaccgcagtcccgaggaggccctg
gcccacgtgcgcgaggtcttcgacggctgcggggtgacggacttcgtggtcgacgaccac
agcggcgcggccctgcccggcctgtcccacccggccgcggcggccttcatcgaggcggtg
ggcggcaccccgcagccgaagtacggctggacggacgtgtcccgcttctcggcgctcggc
gtcccggcggtcaactacggccccggcaacccgcacttggcgcacaagcgcgacgagcgg
gtcgaggtggcgaagatcctcgcgggggaggagcgcctgcgctcctggctgacggcatga

DBGET integrated database retrieval system