KEGG   Streptomyces coelicolor: SCO5144Help
Entry
SCO5144           CDS       T00085                                 

Gene name
SCP8.07c
Definition
(RefSeq) acyl CoA isomerase
  KO
K15866  2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase [EC:5.3.3.18]
Organism
sco  Streptomyces coelicolor
Pathway
sco00360  Phenylalanine metabolism
sco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    SCO5144 (SCP8.07c)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.18  2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase
     SCO5144 (SCP8.07c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 1100585
NCBI-ProteinID: NP_629292
Kitasato: SCO5144
UniProt: Q9FBL4
Position
complement(5591303..5592106)
Genome map
AA seq 267 aa AA seqDB search
MADTVLYEVSDGLATITLNRPEAMNALNIETKVALRDAVRSAAADDAVRAVLLTAAGDRA
FCVGQDLKEHIGLLAADRETGSGQTMSTVREHYNPIVRALAGAEKPVVAAVNGVAAGAGL
GFALAADYRIVADTAAFNTSFAGVALTADSGISWTLPRVVGPGRAADLLLFPRSIRAQEA
YELGIATRVVPAADLRAEAEKTARALAEGPTVAYAALKEAMAYGLTHSLSETLDKEDELQ
SRAGASEDHAIAVRAFVEKGKPKYLGR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaccgtgctctacgaagtgagcgacgggctcgcgacgatcacgctgaaccgc
cccgaggcgatgaacgcgctgaacatcgagaccaaggtcgcgctccgggacgcggtgcgc
tccgcggcggcggacgacgccgtacgggcggtgctgctgaccgcggccggggaccgggcg
ttctgtgtcggccaggacctcaaggagcacatcgggctgctggccgccgaccgggagacg
ggctcggggcagacgatgagcacggtgcgcgagcactacaacccgatcgtccgggcgctg
gccggcgcggagaagccggtggtcgccgccgtgaacggcgtggcggccggcgcggggctc
ggtttcgcgctcgccgcggactaccggatcgtcgcggacacggcggcgttcaacacgtcc
ttcgcgggcgtggcgctcaccgcggactccggcatctcctggacgctgccgcgcgtcgtc
ggccccggccgcgccgccgacctgctgctcttcccgcgcagcatccgcgcgcaggaggcg
tacgagctgggcatcgccacccgtgtcgtccccgccgccgacctgcgcgccgaggccgag
aagacggcgcgggcgctggccgaggggccgacggtggcgtacgcggcgctgaaggaggcg
atggcgtacgggctgacgcactcgctgtccgagacgctggacaaggaggacgagcttcag
tcccgggcgggcgcctccgaggaccacgcgatcgcggtgcgcgcgttcgtcgagaagggg
aagccgaagtatctgggccggtag

DBGET integrated database retrieval system