KEGG   Streptomyces coelicolor: SCO5184Help
Entry
SCO5184           CDS       T00085                                 

Gene name
2SC3B6.08
Definition
(RefSeq) ATP-dependent DNA helicase
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
sco  Streptomyces coelicolor
Pathway
sco03420  Nucleotide excision repair
sco03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SCO5184 (2SC3B6.08)
   03430 Mismatch repair
    SCO5184 (2SC3B6.08)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sco03400]
    SCO5184 (2SC3B6.08)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SCO5184 (2SC3B6.08)
DNA repair and recombination proteins [BR:sco03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SCO5184 (2SC3B6.08)
   MMR (mismatch exicision repair)
    Other MMR factors
     SCO5184 (2SC3B6.08)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 PDDEXK_1 AAA_30 UvrD_C_2
Motif
Other DBs
NCBI-GeneID: 1100625
NCBI-ProteinID: NP_629332
Kitasato: SCO5184
UniProt: Q9FCK4
Position
5638145..5641813
Genome map
AA seq 1222 aa AA seqDB search
MWPDRSRPGPPEPPRRAAGVTRRTTRADLHFPPTREDIRHQLSVAAASLSDVPAHITDPE
QLKELLGIPFTPEQTACIVAPPAPQVIVAGAGSGKTTVMAARVVWLVGTGQVAPEQVLGL
TFTNKAAGELAERVRTALIRAGVTDPDVIDPDHPPGEPAISTYHAFAGRLLTDHGLRLGL
EPTSRLLADATRYQLAARVLREAPGPYPALTRSFADLVSDLLALDGELAEHLVRPEDLRA
WDAGLLDTLDGVRLSNADLRKVPEAAAARRELADLVIRYRAAKRRQDLLDFGDQIALSAQ
LAGLPEVGRVLRDDYRVVLLDEYQDTSVAQRILLAGLFGGGTGHPVTAVGDPCQAIYGWR
GASVANLDDFPEHFAHADGRPAARQALSENRRSGGRLLDLANGLAEPLRAMHAGVEALRP
APGAERDGMVRCALLSTHAEEIDWIADSVAHLVRTGKAPGEIAVLCRTATDFAEIQGALV
ARDVPVEVVGLSGLLHLPEVADLVAVCEVLQDPGANASLVRLLSGPRWRVGPRDLALLGR
RARLLVSHARVEGDDDPDRRLAEAVEGVDPSEVISLADALDTFLETPLDGTGDDDGLPFS
ADARVRFARLATELRELRRALSDPLMDVLHRVLAVTGLEVELSASPHALAARRRETLSNF
LDVAASFAAGDGEATLLAFLGFLRTAAQYEKGLDNALPGGENTVKVLTAHKSKGLEWDVV
AVPGLVTGTFPSGQGREKWTAQGKVLPHGLRGDAETLPDVASWDARGLKAFHEAMKDHQH
TEELRLGYVTFTRPRSLLLGSGHWWGPSQKKPRGPSDFLTALYEHCAAGHGEIEVWADEP
AEDEENPALHRATADEVWPLPLDDAALARRRSAAETVLAHLDGLAAREDGPPSAPATYED
PDWPPPPEDDEGLPEEAEPDRAGDPAHWDSWTTERPAAAREAATAPESPAAPQAGPTVPH
QAPPPEQPPGTAPVPAPARLTPEEARTVASWDRDLDALTGELLRARESVTEVPLPASLTA
SQLLSLAADPDGFAQELARPMPRPPQPAARRGTRFHAWVEARFEPLTLPLLEPEELPGGD
AEIADDHDLEFLKDAFERTEYARRTPFRVEAPFQLSLAGRVVRGRIDAVYKEGDGDTATY
EIVDWKTNRAATADPLQLALYRIAWAEQQHVPPASVTAAFLYVRTGEVVRPEGLPDRAAL
EKLLLAEPVGDEPHDRGVRAGR
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
gtgtggccggaccggagccgccccggcccaccggagccgccgcgccgagcggccggtgtg
acacgtcgcaccacgcgggctgacctgcacttccctccgacccgagaggacatccggcac
cagctgtcagtggccgccgctagcctctctgacgtgcccgcccacatcaccgatcccgag
cagctcaaggagctcctcggcatccccttcacccccgagcagacggcctgcatcgtcgcg
ccgcccgcgccgcaggtgatcgtggccggagccgggtccggcaagacgacggtgatggcg
gcacgcgtggtgtggctggtcggcaccggccaggtcgccccggagcaggtcctcgggctc
accttcaccaacaaggcggccggcgagctcgccgaacgcgtccgtacggccctgatcaga
gcgggcgtgaccgacccggacgtgatcgacccggaccacccgccgggcgagcccgcgatc
tcgacgtaccacgccttcgcgggccgcctcctgaccgaccacggcctgcgtctcggcctt
gagccgacctcccgcctgctcgccgacgccacccgctaccagctcgccgcgagggtcctg
cgcgaggcccccggcccctacccggcgctcacccggtccttcgccgacctggtcagcgac
ctccttgccctcgacggcgaactggccgagcacctcgtgcgccccgaagacctgcgcgcc
tgggacgccggtctcctggacaccctggacggcgtccggctcagcaacgccgacctgcgc
aaggtccccgaggccgccgccgcccgccgcgaactggccgacctggtgatccgctaccgg
gccgccaaacgccggcaggacctgctcgacttcggcgaccagatcgccctgtccgcgcag
ctcgccggactccccgaggtgggccgcgtcctgcgcgacgactaccgggtcgtgctgctg
gacgagtaccaggacacctccgtggcccagcgcatcctcctcgcgggcctgttcggcggc
ggcaccggccatcccgtgaccgccgtgggcgacccctgccaggcgatctacggctggcgc
ggcgcctccgtcgccaacctggacgacttccccgaacacttcgcccacgccgacggacgg
cccgcggcccgccaggcgctcagcgagaaccgccgcagcggcggccgcctcctcgacctc
gccaacggcctcgccgagcccctgcgggccatgcacgcgggcgtggaggcactgcggccc
gccccgggcgccgaacgcgacggcatggtccgctgcgccctgctgagcacccacgccgag
gagatcgactggatcgccgactccgtcgcccacctcgtgcgcaccggcaaggcgcccggt
gagatcgccgtcctgtgccgcacggcgaccgacttcgcggagatccagggcgcgctggtg
gcccgtgacgtccccgtggaggtcgtcggcctgtccgggctgctgcacctgcccgaggtg
gccgacctggtcgccgtctgcgaagtcctccaggacccgggtgccaacgcctctctggtc
cggctgctctccggcccgcgctggcgcgtcggcccgcgcgacctcgccctcctgggacgc
cgcgcccggctgctggtgagccacgcgcgcgtggagggcgacgacgaccccgaccggagg
ctcgccgaggcggtcgagggggtcgacccgtccgaggtgatatcgctcgcggacgccctg
gacaccttcctggagacgccgctggacggcaccggcgacgacgacgggctgcccttctcg
gcggacgcgcgcgtgcggttcgcccggctcgccaccgaactgcgcgagctgcgccgagcc
ctgtccgacccgctcatggacgtcctgcaccgcgtcctcgccgtcaccggcctggaggtc
gagctgtcggcgtccccgcacgccctggcggcccgtcgccgcgagaccctgtcgaacttc
ctcgacgtcgccgcgtccttcgccgcgggcgacggcgaggccaccctgctcgccttcctg
ggcttcttgcgcaccgccgcgcagtacgagaagggcctggacaacgcgctgcccggcggg
gagaacaccgtcaaggtactgaccgcgcacaagtccaagggcctcgagtgggacgtcgtc
gccgtgcccggtctcgtcaccggcaccttccccagcggtcagggccgggagaagtggacc
gcccagggcaaggtgctgccgcacggcctgcgcggcgacgccgagaccctgcccgacgtc
gcctcctgggacgcccgcggtctgaaggcgttccacgaggccatgaaggaccaccagcac
accgaggagctccgcctcggctacgtcaccttcacgcgcccccgctccctgctcctcggc
tccggccactggtgggggcccagccagaagaagccccgcggtccgtccgacttcctgacg
gccctgtacgagcactgcgcggccggacacggcgagatcgaggtctgggcggacgaaccg
gcggaggacgaggagaaccccgccctgcaccgggcgaccgccgacgaggtctggccgctg
cccctggacgacgcggcactcgcgcggcgccgttcggccgccgagacggtcctcgcccac
ctggacggactcgccgcccgggaagacggtcccccctccgcccccgccacctacgaggac
ccggactggccgccgcccccggaggacgacgagggactcccggaggaagcggagcccgac
cgggccggggaccccgcccactgggacagctggaccacggagcgccccgccgccgcgcgg
gaggccgccaccgcgccggagagccctgccgccccgcaggccggccccaccgtcccgcac
caggcgccgccccccgaacagcccccgggcaccgcgcccgtccccgctcccgctcgcctc
acaccggaggaggcccgcaccgtcgcctcctgggaccgcgacctcgacgcgctcaccgga
gagctcctgcgcgcccgcgagagcgtcaccgaagtgccccttccggcgtcgctgaccgcc
tcccagctgctgagcctggccgccgacccggacgggttcgcccaggagctggcccggccc
atgccccgcccgccccagcccgccgcccgccgcggcacccgattccacgcctgggtggag
gcccggttcgaaccgctgaccctgccgttgctcgaaccggaagagttgcccggcggcgac
gccgagatcgccgacgaccacgacctggagttcctgaaggacgccttcgagcgcaccgag
tacgcccgccgcaccccgttccgtgtcgaggcgccgttccagctctcgctcgccgggcgg
gtcgtacgcggccgcatcgacgccgtctacaaggagggcgacggcgacaccgcgacgtac
gagatcgtcgactggaagaccaaccgcgccgccaccgccgacccgctccagctcgcgctc
taccgcatcgcctgggccgaacagcagcacgtaccgcccgcctcggtgacggccgccttc
ctgtacgtacgcaccggcgaggtcgtacggcccgaggggctgccggaccgcgcggcgctc
gagaagctgctgctggccgagccggtcggtgacgaaccgcacgaccggggtgtccgcgcg
ggccgatag

DBGET integrated database retrieval system