KEGG   Streptomyces coelicolor: SCO5261Help
Entry
SCO5261           CDS       T00085                                 

Gene name
2SC7G11.23
Definition
(RefSeq) malate oxidoreductase
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
sco  Streptomyces coelicolor
Pathway
sco00620  Pyruvate metabolism
sco01200  Carbon metabolism
sco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO5261 (2SC7G11.23)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SCO5261 (2SC7G11.23)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     SCO5261 (2SC7G11.23)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M ELFV_dehydrog ThiF Shikimate_DH 2-Hacid_dh_C Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 1100702
NCBI-ProteinID: NP_629407
Kitasato: SCO5261
UniProt: Q9F3K4
Position
5720101..5721330
Genome map
AA seq 409 aa AA seqDB search
MAAEIVNPRSDSEAGAEQEAGAEPLDSFDPAFALHRGGKMAVQATVPIRDKEDLSLAYTP
GVAKVCSAIAEQPDLVHDYTWKSSVVAVVTDGTAVLGLGDIGPEASLPVMEGKAILFKQF
GGVDAVPIALNCTDADEIVETVVRLAPSFGGVNLEDISAPRCFEIERKLQERLDIPVFHD
DQHGTAVVTLAALRNAARLSGRTLGELRAVISGAGAAGVAIAKMLVEAGIGDVAVADRKG
VVSADREDLTPVKQELASFTNKAGLSGPLEAALAGADVFIGVSGGTVPEPAVASMAEGAF
VFAMANPNPEVHPEVAHKYAAVVATGRSDFPNQINNVLAFPGIFAGALQVRASRITEGMK
LAAAEALASVVGDDLAADYVIPSPFDERVAPAVTAAVAAAARAEGVARR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcggagatcgtcaatcctcgcagcgacagcgaagccggtgcggagcaggaggcg
ggcgccgagccgctcgactccttcgaccccgcgttcgcgctgcaccgcggcggcaagatg
gccgtgcaggccaccgtgccgatccgcgacaaggaagacctgtccctggcgtacacgccc
ggcgtcgcgaaagtgtgcagcgcgatcgccgagcagcccgacctcgtccacgactacacc
tggaagtcgtcggtcgtcgcggtcgtgacggacggcacggcggtgctggggctcggtgac
atcgggcccgaggcgtccctcccggtgatggagggcaaggccatcctcttcaagcagttc
ggcggcgtggacgcggtcccgatcgccctgaactgcacggacgccgacgagatcgtcgag
accgtggtccggctcgcgccctccttcggcggcgtcaacctggaggacatctcggcgccg
cggtgcttcgagatcgagcgcaagctccaggagcgcctggacatcccggtcttccacgac
gaccagcacggcacggccgtcgtgacgctggccgccctgcggaacgcggcgcggctgagc
gggcggacgctgggtgagctgcgggcggtgatctcgggcgcgggtgcggccggggtcgcc
atcgccaagatgctggtggaggccggcatcggggacgtcgcggtcgccgaccgcaagggt
gtcgtttcggccgaccgggaggacctgaccccggtcaagcaggagttggcctccttcacc
aacaaggccgggctctccggccccctggaggcggcgctcgcgggtgccgacgtcttcatc
ggcgtctccggcggtacggtgcccgagccggcggtggcctcgatggccgagggtgccttc
gtcttcgcgatggccaacccgaacccggaggtgcatccggaggtcgcccacaagtacgcg
gcggtcgtcgcgacggggcgctcggacttcccgaaccagatcaacaacgtgctggcgttc
ccgggcatcttcgcgggcgctctccaggtgcgggcgtcgcggatcaccgagggcatgaag
ctggcggcggccgaggcgctggcctccgtggtgggggacgaccttgccgcggactatgtc
attccgtccccgttcgacgagcgggtcgcgccggccgtgacggcggcggtggccgcggcg
gcccgggcggagggggttgcgcgccggtga

DBGET integrated database retrieval system