KEGG   Streptomyces coelicolor: SCO5262Help
Entry
SCO5262           CDS       T00085                                 

Gene name
2SC7G11.24
Definition
(RefSeq) dehydrogenase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N MoeA_N ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 1100703
NCBI-ProteinID: NP_629408
Kitasato: SCO5262
UniProt: Q9F3K3
Position
5721695..5722660
Genome map
AA seq 321 aa AA seqDB search
MFAVYAARIDRDQPLAGLELGELPAPEARPGWSVVDVRAASLNHHDLWSLRGVGLPEDRL
PMILGCDAAGIDADGNEVVLHSVIGQTGHGVGPKEPRSILTERYPGTFAEQVAVPTWNIL
PKPKELSFEEAACLPTAWLTAYRMLFTNAGVRPGDSVLVQGAGGGVATAAIVLGKAAGLR
VFATSRDEAKRKRALELGAVEAVETGARLPQRVDAVIETVGAATWSHSIKSLRPGGTLVI
SGATSGDRPSHAELTRIFFLELKVVGSTMGSKDELEDLLSFCAATGVRPVIDEVLPMDRA
RDGFERMASGGQFGKIVLSNS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctgtctatgccgcccgaatcgaccgcgaccagccgttggccggcctggagttg
ggagagcttccggctcccgaggcccggccgggctggagcgtcgtcgatgtcagggccgcc
tccctcaaccaccacgacctgtggtccctgcgcggcgtcggcctccccgaggaccggctg
ccgatgatcctcggctgcgacgccgccgggatcgacgcggacggcaacgaggtcgtcctg
cactccgtgatcggccagaccggccacggcgtcggccccaaggagccccgctccattctc
accgagcgctatccggggacgttcgccgagcaggtcgccgtgccgacctggaacatcctg
cccaagcccaaggagctctccttcgaggaggccgcctgcctgccgaccgcctggctgacg
gcgtaccggatgctgttcaccaacgccggggtgcgtcccggtgactcggtgctggtgcag
ggcgccggcggcggggtcgccacggccgcgatcgtgctcggcaaggcggccgggctgcgg
gtcttcgccaccagccgggacgaggccaagcgcaagcgggcgctggagctcggtgcggtg
gaggccgtcgagacgggtgcgcggctgccgcagcgggtcgacgccgtgatcgagaccgtg
ggcgccgccacctggtcgcactccatcaagtcgctgcgtcccggcggcacgctggtcatc
tccggtgccaccagcggtgaccggccctcccacgccgaactcacccggatcttcttcctg
gagctcaaggtcgtcggctccacgatgggctccaaggacgagctggaggacctgctgtcc
ttctgcgccgccaccggtgtgcgtcccgtcatcgacgaggtacttccgatggaccgggcc
cgtgacgggttcgagcggatggcctccggggggcagttcggcaagatcgtgctcagcaac
tcctga

DBGET integrated database retrieval system