KEGG   Streptomyces coelicolor: SCO5353Help
Entry
SCO5353           CDS       T00085                                 

Gene name
lysA, SCBAC5H2.22
Definition
(RefSeq) diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
sco  Streptomyces coelicolor
Pathway
sco00300  Lysine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SCO5353 (lysA)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     SCO5353 (lysA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC Ala_racemase_N
Motif
Other DBs
NCBI-GeneID: 1100793
NCBI-ProteinID: NP_629493
Kitasato: SCO5353
UniProt: Q9ADB5
Position
5820662..5822053
Genome map
AA seq 463 aa AA seqDB search
MSRSAHPAGPRHADVLPEGHYTAPADDLNALDPKVWARTVGRDADGVVTVGGIPVTQLAE
EYGTPAYLLDEADFRERARAWRTAFGDDADVFYAGKAFLSRAVVRWLDEEGLNLDVCSGG
ELATALSAGMPAERIAFHGNNKSPEEIERAVRAGVGRIVLDSFQEIVRVAHIAQSLGKRQ
RVQIRITVGVEAHTHEFIATAHEDQKFGIPLAGGQAAEAVRRALKLDGLEVIGIHSHIGS
QIFDMSGFEVAAHRVVGLLKDIRDEHGVELPEIDLGGGLGIAYTSDDDPREPHEIAKALT
EIVTRECEAARLATPRISVEPGRAIVGPTAFTLYEVGTVKPLEGLRTYVSVDGGMSDNIR
TALYDAEYSVALASRTSDAEPMLVRVVGKHCESGDIVVKDAFLPGDLAPGDLIAVPATGA
YCRSMASNYNHALRPPVVAVRDGAARVVVRRETEEDLLRLDVG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttccgcacaccccgccgggccccgccacgccgacgtcctgcccgaggggcac
tacaccgccccggccgacgacctcaacgccctcgatcccaaggtctgggcccgcaccgtc
gggcgggacgcggacggggtcgtcaccgtcggcgggattcccgtcacgcagctcgccgag
gagtacggcacccccgcctacctcctcgacgaggccgacttccgggagcgggcgcgggcg
tggcgcaccgcgttcggcgacgacgccgacgtcttctacgccgggaaggccttcctgtcg
cgcgcggtcgtgcggtggctggacgaggaagggctcaacctcgacgtgtgttcggggggc
gagctcgccaccgccctctccgccgggatgcccgccgagcggatcgccttccacggcaac
aacaagtcgccggaggagatcgagcgtgccgtccgggccggggtcgggcggatcgtgctc
gactccttccaggagatcgtgcgggtggcccacatcgcccagtcgctcggcaagcggcag
cgggtgcagatccggatcaccgtcggggtcgaggcgcacacgcacgagttcatcgccacc
gcccacgaggaccagaagttcggtatcccgctggccggcgggcaggcggcggaggccgtg
cggcgggccctgaagctggacgggctcgaggtcatcgggatccactcgcacatcgggtcc
cagatcttcgacatgtcggggttcgaggtcgccgcgcaccgggtcgtgggactgctcaag
gacatccgggacgagcacggcgtcgagctgcccgagatcgacctcgggggcgggctcggc
atcgcgtacaccagtgacgacgacccccgcgagccgcacgagatcgccaaggcgctgacc
gagatcgtgacgcgggagtgcgaggccgcccgactcgccaccccccgcatctccgtcgag
cccgggcgggccatcgtggggccgaccgccttcaccctgtacgaggtcggcaccgtcaag
cccctcgaagggctgcggacctacgtctccgtcgacggcgggatgtcggacaacatccgg
accgcgctctacgacgccgagtacagcgtcgccctcgcctcgcgcacctccgacgccgag
ccgatgctcgtgcgcgtcgtcggcaagcactgcgagagcggggacatcgtggtcaaggac
gccttcctgccgggggacctggcacccggtgacctgatcgccgtaccggcgacgggggcg
tactgccgctccatggccagcaactacaaccacgcgctgcggccgccggtcgtcgccgtg
cgggacggtgcggcgcgggtcgtcgtgcggcgggagaccgaggaggatctgctgcgtctc
gacgtcgggtga

DBGET integrated database retrieval system