KEGG   Streptomyces coelicolor: SCO5354Help
Entry
SCO5354           CDS       T00085                                 

Gene name
SCBAC5H2.23, thrA
Definition
(RefSeq) homoserine dehydrogenase
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00270  Cysteine and methionine metabolism
sco00300  Lysine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO5354 (SCBAC5H2.23)
   00270 Cysteine and methionine metabolism
    SCO5354 (SCBAC5H2.23)
   00300 Lysine biosynthesis
    SCO5354 (SCBAC5H2.23)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     SCO5354 (SCBAC5H2.23)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homoserine_dh NAD_binding_3 ACT ACT_6 ACT_4 Sacchrp_dh_NADP Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 1100794
NCBI-ProteinID: NP_629494
Kitasato: SCO5354
UniProt: Q9ADB4
Position
5822215..5823504
Genome map
AA seq 429 aa AA seqDB search
MRTRPLKVALLGCGVVGSKVARIMTTHAADLAARIGAPVELAGVAVRRPDKVREGIDPAL
VTTDATALVKRGDIDVVVEVIGGIEPARTLITTAFAHGASVVSANKALIAQDGAALHAAA
DEHGKDLYYEAAVAGAIPLIRPLRESLAGDKVNRVLGIVNGTTNFILDAMDSTGAGYQEA
LDEATALGYAEADPTADVEGFDAAAKAAILAGIAFHTRVRLDDVYREGMTEVTAADFASA
KEMGCTIKLLAICERAADGGSVTARVHPAMIPLSHPLANVREAYNAVFVESDAAGQLMFY
GPGAGGSPTASAVLGDLVAVCRNRLGGATGPGESAYAALPVSPMGDVVTRYHISLDVADK
PGVLAQVATVFAEHGVSIDTVRQSGKDGEASLVVVTHRASDAALGGTVEALRKLDTVRGV
ASIMRVEGE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacgcgtccgctgaaggtggcgctgctgggctgtggagtggtcggctcaaaggtg
gcgcgcatcatgacgacgcacgccgccgacctcgccgcccggatcggggccccggtggag
ctcgcgggcgtcgccgtacggcggcccgacaaggtgcgggaggggatcgacccggccctc
gtcaccaccgacgccaccgcgctcgtcaagcgcggggacatcgacgtcgtcgtcgaggtc
atcggggggatcgagcccgcgcggacgctcatcaccaccgccttcgcgcacggcgcctcc
gtggtctccgccaacaaggcgctcatcgcccaggacggcgccgccctgcacgccgccgcc
gacgagcacggcaaggacctgtactacgaggccgccgtcgccggtgccatcccgctgatc
cggccgctgcgcgagtccctcgccggcgacaaggtcaaccgggtgctcggcatcgtcaac
gggaccaccaacttcatcctcgacgccatggactcgaccggggccggctatcaggaagcg
ctcgacgaggccacggccctcgggtacgccgaggccgacccgaccgccgacgtcgagggc
ttcgacgccgcagccaaggccgccatcctcgccgggatcgccttccacacgcgcgtacgc
ctcgacgacgtctaccgcgagggcatgaccgaggtcaccgccgccgacttcgcctccgcc
aaggagatgggctgcaccatcaagctgctcgccatctgcgagcgggcggcggacggaggg
tcggtcaccgcacgcgtgcatcccgcgatgatcccgctcagccatccgctggccaacgtg
cgcgaggcgtacaacgccgtgttcgtggagtccgacgccgccggtcagctcatgttctac
gggcccggcgccggcggttcgccgaccgcgtccgccgtgctcggcgacctggtggccgtg
tgccgcaaccggctgggcggagcgaccggacccggtgagtccgcgtacgccgccctgccc
gtctccccgatgggcgacgtcgtcacgcgctaccacatcagcctcgacgtggccgacaaa
ccgggcgtgctcgcccaggtcgcgaccgtgttcgcggagcacggtgtctccatcgacacc
gtgcggcagtccggcaaggacggcgaggcatccctcgtcgtcgtcacccatcgcgcgtcc
gacgccgccctcggcggtacggtcgaggcgctgcgcaagctcgacaccgtgcggggtgtc
gccagcatcatgcgggttgaaggagagtaa

DBGET integrated database retrieval system