KEGG   Streptomyces coelicolor: SCO5355Help
Entry
SCO5355           CDS       T00085                                 

Gene name
SCBAC5H2.24, thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00750  Vitamin B6 metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01230  Biosynthesis of amino acids
Module
sco_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO5355 (SCBAC5H2.24)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCO5355 (SCBAC5H2.24)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCO5355 (SCBAC5H2.24)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 1100795
NCBI-ProteinID: NP_629495
Kitasato: SCO5355
UniProt: Q9ADB3
Position
5823511..5824569
Genome map
AA seq 352 aa AA seqDB search
MTHQWRGIIEEYRDRLPVSDSTPVVTLREGGTPLVPAQVLSERTGCEVHLKVEGANPTGS
FKDRGMTMAISKAKEEGAQAVICASTGNTSASAAAYGVRAGMVSAVLVPQGKIALGKMGQ
ALVHGAKILQVDGNFDDCLTLARALSDNYPVALVNSVNPVRIEGQKTAAFEIVDMLGDAP
DIHVLPVGNAGNITAYWKGYQEYAADGVSTKKPRMWGFQASGSAPIVRGEVVKDPSTIAT
AIRIGNPASWDFALAARDESGGAIDEVTDREILRAYRLLASQEGVFVEPASAASVAGLLK
AAEQGKVDPGQRIVCTVTGNGLKDPDWAVAGAPQPVTVPVDAATAAERLGLV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccagtggcgcggaatcatcgaggagtaccgggaccggctgcccgtctccgac
agcacgcccgtcgtgacgctccgtgagggcggcaccccgctcgtgcccgcgcaggtgctc
tccgagcgcacgggctgcgaggtccacctcaaggtcgagggggcgaacccgaccgggtcc
ttcaaggaccgtggcatgaccatggccatcagcaaggccaaggaggagggcgcgcaggcc
gtcatctgcgcgtccaccgggaacacgtccgcgagtgccgccgcgtacggcgtgcgcgcg
ggcatggtctccgccgtgctcgtgccgcagggcaagatcgcgctcggcaagatgggccag
gccctcgtgcacggcgcgaagatcctccaggtcgacggcaacttcgacgactgcctcacg
ctggcccgtgcgctcagcgacaactacccggtggcactggtcaattcggtcaacccggtg
cgtatcgaggggcagaagacggccgccttcgagatcgtggacatgctcggcgacgcgccc
gacatacatgtccttcccgtgggcaacgcgggcaacatcaccgcgtactggaaggggtac
caggagtacgccgccgacggggtcagcaccaagaagccccgcatgtgggggttccaggcc
tccggctccgccccgatcgtgcgcggcgaggtcgtcaaggacccgtcgaccatcgccacc
gccatccggatcggcaaccccgcctcgtgggacttcgcgctcgccgcgcgcgacgagtcg
ggcggcgccatcgacgaggtgacggaccgtgagatcctgcgcgcctaccggctgttggcc
tcgcaggagggcgtcttcgtggagcccgcctccgccgcctccgtggccggtctgctgaag
gccgccgagcagggcaaggtcgacccggggcagcgcatcgtgtgcaccgtcaccggcaac
gggctgaaggacccggactgggccgtcgccggcgcgccgcagccggtcaccgtcccggtc
gacgcggcgacggcggccgagcggctcgggctggtctga

DBGET integrated database retrieval system