KEGG   Streptomyces coelicolor: SCO5356Help
Entry
SCO5356           CDS       T00085                                 

Gene name
SCBAC5H2.25, thrB
Definition
(RefSeq) homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01230  Biosynthesis of amino acids
Module
sco_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO5356 (SCBAC5H2.25)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     SCO5356 (SCBAC5H2.25)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 1100796
NCBI-ProteinID: NP_629496
Kitasato: SCO5356
UniProt: Q9ADB2
Position
5824855..5825784
Genome map
AA seq 309 aa AA seqDB search
MAGPAFRAAAVRVRVPATSANLGPGFDALGLALGLYDDVVVRVADSGLHIDIAGEGSETL
PRDEKHLLVRSLRTAFDLLGGQPRGLEIVCANRIPHGRGLGSSSAAICAGIVAARAVTIG
GEARLDDAALLDLATEIEGHPDNVAACLLGGFTLSWMESGAARAIRMEPSDSIVPVVFVP
GKPVLTQTARGLLPRSVPHVDAAANAGRAALLVEALTRRPELLLPATEDRLHQEYRAPAM
PESTALVERLRGDGIPAVISGAGPTVMALADADTADKVEALAGTDWAANRLGLDQQGATV
LPLATASDT
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggccggtccagcgttccgcgccgccgccgtcagggtgcgcgtccccgccaccagcgcc
aacctcggtccgggcttcgacgccctgggcctcgcgctgggtctgtacgacgacgtggtc
gtccgggtggccgactccgggctgcacatcgacatcgcgggtgagggcagcgagaccctt
ccgcgcgacgagaagcacctcctcgtccgctccctgcgcaccgccttcgacctgctcggc
gggcagccgcgcggcctggagatcgtctgcgccaaccgcatcccgcacggccgcggcctc
ggctcctcctctgccgccatctgcgccggaatcgtcgccgcgcgcgccgtgacgataggc
ggcgaggcccgcctcgacgacgccgcgctgctcgacctcgccaccgagatcgagggccac
cccgacaacgtggcggcctgtctcctgggcggattcaccctttcctggatggagtccggc
gccgcccgggcgatcaggatggagccctccgattccatcgttccggtggttttcgtgccc
ggaaagccggtactgacccagaccgcgcgcgggctgctcccgcgcagcgttccgcacgtc
gacgccgccgccaacgccggccgcgccgcgctgctcgtcgaggccctcaccaggcgcccc
gagctgctgctgccggccaccgaggaccgcctgcaccaggagtaccgcgcgccggccatg
ccggagagcacggcgctggtggaaaggctgcgtggcgacggcattcccgcggtgatctcg
ggtgccggacccacggtgatggcactggccgacgccgacacggccgacaaggtcgaggcg
ctggccggaacggactgggcggccaaccggctcggcctggaccagcagggcgcgaccgtc
ctgcccctggcgaccgccagcgacacctga

DBGET integrated database retrieval system