KEGG   Streptomyces coelicolor: SCO5415Help
Entry
SCO5415           CDS       T00085                                 

Gene name
icmA, SC8F4.19
Definition
(RefSeq) isobutyryl-CoA mutase A
  KO
K01848  methylmalonyl-CoA mutase, N-terminal domain [EC:5.4.99.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00280  Valine, leucine and isoleucine degradation
sco00630  Glyoxylate and dicarboxylate metabolism
sco00640  Propanoate metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01200  Carbon metabolism
Module
sco_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO5415 (icmA)
   00640 Propanoate metabolism
    SCO5415 (icmA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO5415 (icmA)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     SCO5415 (icmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MM_CoA_mutase
Motif
Other DBs
NCBI-GeneID: 1100855
NCBI-ProteinID: NP_629554
Kitasato: SCO5415
UniProt: Q9X949 Q7AKG5
Position
5883756..5885456
Genome map
AA seq 566 aa AA seqDB search
MDAHAIEEGRLRWQARYDAARKRDADFTTLSGDPVEPVYGPRPGDEYEGFERIGWPGEYP
FTRGLYPTGYRGRTWTIRQFAGFGNAEQTNERYKMILRNGGGGLSVAFDMPTLMGRDSDD
PRSLGEVGHCGVAIDSAADMEVLFKDIPLGDVTTSMTISGPAVPVFCMYLVAAERQGVDA
SVLNGTLQTDIFKEYIAQKEWLFQPEPHLRLIGDLMEYCAAGIPAYKPLSVSGYHIREAG
ATAAQELAYTLADGFGYVELGLSRGLDVDVFAPGLSFFFDAHLDFFEEIAKFRAARRIWA
RWMRDVYGARTDKAQWLRFHTQTAGVSLTAQQPYNNVVRTAVEALAAVLGGTNSLHTNAL
DETLALPSEQAAEIALRTQQVLMEETGVANVADPLGGSWFIEQLTDRIEADAEKIFEQIK
ERGLRAHPDGQHPVGPITSGLLRGIEDGWFTGEIAESAFRYQQSLEKDDKKVVGVNVHTG
SVTGDLEILRVSHEVEREQVRVLGERKDARDDAAVRGALDAMLAAARSGGNMIGPMLDAV
RAEATLGEICGVLRDEWGVYTEPAGF
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggacgctcatgccatagaggagggccgccttcgctggcaggcccggtacgacgcggcg
cgcaagcgcgacgcggacttcaccacgctctccggagaccccgtggagccggtgtacggg
ccccgccccggggacgagtacgagggcttcgagcggatcggctggccgggcgagtacccc
ttcacccgcggcctgtatccgaccgggtaccgggggcgtacgtggaccatccggcagttc
gccgggttcggcaacgccgagcagaccaacgagcgctacaagatgatcctccgcaacggc
ggcggcgggctctcggtcgccttcgacatgccgaccctgatgggccgcgactccgacgac
ccgcgctcgctgggcgaggtcgggcactgcggggtggccatcgactcggccgccgacatg
gaagtgctgttcaaggacatcccgctcggggacgtgacgacctccatgacgatcagcggg
cccgccgtgcccgtgttctgcatgtacctcgtcgccgccgagcgccagggcgtcgacgca
tccgtgctcaacggcacgctgcagaccgacatcttcaaggagtacatcgcccagaaggag
tggctcttccagcccgagccccacctccggctcatcggcgacctcatggagtactgcgcg
gccggcatccccgcctacaagccgctctccgtctccggctaccacatccgcgaggcgggc
gcgacggccgcgcaggagctggcgtacacgctcgccgacggcttcggatacgtggagctg
ggcctcagccgcgggctcgacgtggacgtcttcgcgcccggcctctccttcttcttcgac
gcgcacctcgacttcttcgaggagatcgccaagttccgcgcggcccgcaggatctgggcc
cgctggatgcgcgacgtgtacggcgcgcggaccgacaaggcccagtggctgcggttccac
acccagaccgccggagtctcgctcaccgcgcagcagccgtacaacaacgtcgtacgcacc
gcggtggaggcgctggcggccgtgctcggcggcaccaactccctgcacaccaacgcgctc
gacgagaccctcgccctgcccagcgagcaggccgccgagatcgccctgcgcacccagcag
gtgctgatggaggagaccggcgtcgccaacgtcgccgacccgctgggcggttcctggttc
atcgagcagctgaccgaccgcatcgaggccgacgccgagaagatcttcgagcagatcaag
gagcgggggctgcgcgcccaccccgacgggcagcaccccgtcggaccgatcacctccggc
ctgctgcgcggcatcgaggacggctggttcaccggcgagatcgccgagtccgccttccgc
taccagcagtccttggagaaggacgacaagaaggtggtcggcgtcaacgtccacaccggc
tccgtcaccggcgacctggagatcctgcgggtcagccacgaggtcgagcgcgagcaggtg
cgggtcctgggcgagcgcaaggacgcccgggacgacgccgccgtgcgcggcgccctggac
gccatgctggccgcggcccgctccggcggcaacatgatcgggccgatgctggacgcggtg
cgcgcggaggcgacgctgggcgagatctgcggtgtgctgcgcgacgagtggggggtgtac
acggaaccggcggggttctga

DBGET integrated database retrieval system