KEGG   Streptomyces coelicolor: SCO5423Help
Entry
SCO5423           CDS       T00085                                 

Gene name
pyk2, SC8F4.27c
Definition
(RefSeq) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00230  Purine metabolism
sco00620  Pyruvate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00002  Glycolysis, core module involving three-carbon compounds
sco_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
sco_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO5423 (pyk2)
   00620 Pyruvate metabolism
    SCO5423 (pyk2)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO5423 (pyk2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sco04131]
    SCO5423 (pyk2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO5423 (pyk2)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     SCO5423 (pyk2)
Membrane trafficking [BR:sco04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SCO5423 (pyk2)
Exosome [BR:sco04147]
 Exosomal proteins
  Proteins found in most exosomes
   SCO5423 (pyk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI CorC_HlyC
Motif
Other DBs
NCBI-GeneID: 1100863
NCBI-ProteinID: NP_629562
Kitasato: SCO5423
UniProt: Q9L299
Position
complement(5892975..5894405)
Genome map
AA seq 476 aa AA seqDB search
MRRSKIVCTLGPAVDSHEQLVTLIEAGMNVARFNFSHGTHAEHQGRYDRVRAAAKETGRA
IGVLADLQGPKIRLETFAEGPVELVRGDEFTITAEDVPGDRTICGTTYKGLPGDVTKGDQ
VLINDGNVELKVTEVEGPRVKTIVIEGGVISDHKGINLPGAAVNVPALSEKDVEDLRFAL
RMGCDLVALSFVRDAKDVADVHRVMDEEGRRVPVIAKVEKPQAVDNMEDVVMAFDGVMVA
RGDLAVEYPLEKVPMVQKRLIELCRRNAKPVIVATQMMESMITNSRPTRAEASDVANAIL
DGADAVMLSAESSVGAYPIETVKTMSKIVTAAEQELLSKGLQPLVPGKKPRTQGGSVARA
AAEIADFLGGKGLVAFTQSGDTARRLSRYRAAQPILAFTTDESTRNQLALSWGVEPHVVP
FVNTTDEMVDLVDQETARLGRFSDGDTVVITAGSPPGVSGTTNMVRVLHLGETRRG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgttcgaaaatcgtctgtactctcggccccgcggtcgactcccacgagcagctc
gtcacgctgatcgaagccggcatgaacgtggcccgcttcaacttcagccatggcacccac
gccgagcaccagggtcgttacgaccgggtccgggccgccgccaaggagaccggccgggcc
atcggcgtcctcgccgacctccagggcccgaagatccgcctggagaccttcgcggagggc
cccgtcgagctggtgcgcggtgacgagttcaccatcaccgccgaggacgtcccgggcgac
aggacgatctgcggcacgacctacaagggcctgcccggtgacgtcaccaagggcgaccag
gtgctcatcaacgacggcaacgtcgagctgaaggtcaccgaggtcgagggcccccgggtg
aagacgatcgtcatcgagggcggcgtcatctccgaccacaagggcatcaacctgccgggc
gcggcggtcaacgtccccgcgctgagcgagaaggacgtcgaggacctccggttcgcgctg
cgcatgggctgcgacctggtcgccctctccttcgtccgggacgccaaggacgtcgccgac
gtgcaccgcgtcatggacgaggagggccgccgggtcccggtgatcgccaaggtcgagaag
ccccaggcggtcgacaacatggaggacgtcgtgatggcgttcgacggcgtgatggtcgcc
cgtggcgacctggccgtcgagtacccgctcgagaaggtccccatggtgcagaagcgcctg
atcgagctgtgccggcgcaacgccaagccggtgatcgtggcgacccagatgatggagtcg
atgatcacgaactcccggccgacccgcgccgaggcctccgacgtggccaacgcgatcctg
gacggcgccgacgcggtcatgctgtccgccgagtcgagcgtgggcgcctacccgatcgag
accgtcaagacgatgtcgaagatcgtcaccgccgccgagcaggagctgctctccaagggc
ctccagccgctggtgccgggcaagaagccgcgcacgcagggcggttcggtggcccgtgcg
gccgccgagatcgccgacttcctgggcggcaagggcctggtcgccttcacccagtccggc
gacaccgcccgccggctctcccgctatcgcgcggcccagccgatcctcgccttcaccacc
gacgagtccacccgcaaccagctggcgctcagctggggagtggagccgcacgtggtgccg
ttcgtgaacaccacggacgagatggtggacctggtggaccaggagacggcccgcctcggc
cggttcagcgacggcgacaccgtcgtgatcaccgccggttcgccccccggcgtgtccggc
accaccaacatggtgcgggtcctccacctgggcgagacacggcgcggctga

DBGET integrated database retrieval system