KEGG   Streptomyces coelicolor: SCO5424Help
Entry
SCO5424           CDS       T00085                                 

Gene name
ackA, SC8F4.28c
Definition
(RefSeq) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00430  Taurine and hypotaurine metabolism
sco00620  Pyruvate metabolism
sco00640  Propanoate metabolism
sco00680  Methane metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01200  Carbon metabolism
Module
sco_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO5424 (ackA)
   00640 Propanoate metabolism
    SCO5424 (ackA)
  Energy metabolism
   00680 Methane metabolism
    SCO5424 (ackA)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SCO5424 (ackA)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     SCO5424 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-GeneID: 1100864
NCBI-ProteinID: NP_629563
Kitasato: SCO5424
UniProt: Q9L298
Position
complement(5894480..5895703)
Genome map
AA seq 407 aa AA seqDB search
MSSTRVLVLNSGSSSVKYQLIDMRDGERLAAGLVERIGERTSRLRHTLVAAGDTREQEGP
IADHEAALKAVAAELGRDGLGLDSPELAAIGHRVVHGGEFFSEPTLIDENVLTEIERLIP
VAPLHNPANLTGIRTAQALRPDLPQVAVFDTAFHTTMPESAARYAIDPKIADRYRIRRYG
FHGTSHAYVSRETARLLGRAPGDVNVIVLHLGNGASASAVRGGRCVDTSMGLTPLEGLVM
GTRSGDMDPAVIFHLMRVGGMSADEIDTLLNKRSGLFGLCGDNDMREIRRRVDEDDEQAG
LAFDIYIHRLKKYIGAYYAVLGRVDAVAFTAGVGENSAPVREAAVAGLEGLGLAVDGGLN
AVRGDGARLISPAGARVAVAVVPTDEEMEIATQTYALVSESGNPDLT
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgagctccacgcgtgtcctcgtcctcaactccggctcctcgtcggtgaagtaccagctg
atcgacatgcgcgacggggagcggctggcggccgggctggtcgagcgcatcggtgagcgg
acgtcgcggctgaggcacaccctcgtggccgccggcgacacccgggagcaggagggcccg
atcgccgaccacgaggccgccctgaaggcggtcgccgccgagctgggccgggacggtctg
ggcctggactccccggagctggccgcgatcgggcaccgcgtggtgcacggcggcgagttc
ttcagcgagcccaccctgatcgacgagaacgtgctcacggagatcgagcggctgatcccg
gtcgcgccgctgcacaacccggccaacctcaccggcatccgcaccgcgcaggcgctccgt
cccgacctgccgcaggtggcggtcttcgacaccgcgttccacaccacgatgccggagtcc
gcggcgcgctacgcgatcgacccgaagatcgccgaccggtaccgcatccgccgctacggc
ttccacggcacctcgcacgcgtacgtctcccgcgagaccgcgcggctgctgggcagggcg
ccgggcgacgtgaacgtgatcgtgctgcacctgggcaacggggcgtccgcctcggccgtg
cggggcggccggtgcgtggacacctccatgggcctgacgcccttggaaggactcgtgatg
ggtacgcgctcgggagacatggacccggccgtcatcttccatttgatgcgcgttggcgga
atgtccgccgacgagatcgacactcttctcaacaagaggagcggtctgttcggtctgtgc
ggtgacaacgacatgcgggagatccgccgccgggtggacgaggacgacgagcaggcgggg
ctggccttcgacatctacattcaccggctcaagaagtacatcggcgcctattacgccgtt
ctcggacgcgtggacgccgtggcgttcacggcgggggtcggggagaactcggcacccgtg
cgcgaggcggccgtggccggactggaggggctcggcctggcggtcgacggcgggctgaac
gccgtacgcggcgacggagcccggctgatctcgcccgcgggggcgcgggtggccgtggcg
gtggtaccgacggacgaggaaatggagatcgcgacacagacctacgcgctggtaagtgaa
tcggggaatcccgatctcacctga

DBGET integrated database retrieval system