KEGG   Streptomyces coelicolor: SCO5425Help
Entry
SCO5425           CDS       T00085                                 

Gene name
pta, SC6A11.01c, SC8F4.29c
Definition
(RefSeq) phosphate acetyltransferase
  KO
K13788  phosphate acetyltransferase [EC:2.3.1.8]
Organism
sco  Streptomyces coelicolor
Pathway
sco00430  Taurine and hypotaurine metabolism
sco00620  Pyruvate metabolism
sco00640  Propanoate metabolism
sco00680  Methane metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01200  Carbon metabolism
Module
sco_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO5425 (pta)
   00640 Propanoate metabolism
    SCO5425 (pta)
  09102 Energy metabolism
   00680 Methane metabolism
    SCO5425 (pta)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SCO5425 (pta)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     SCO5425 (pta)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB DRTGG AAA_26
Motif
Other DBs
NCBI-GeneID: 1100865
NCBI-ProteinID: NP_733663
Kitasato: SCO5425
UniProt: Q8CJR5
Position
complement(5895700..5897793)
Genome map
AA seq 697 aa AA seqDB search
MTRSVYVTGIDRGDGRQVVELGVMELLTRQVDRVGVFRPLVHDGPDRLFELLRARYRLSQ
DPATVYGMDYQEASLLQAEQGVDELVSALVDRFHLVARDYDVVLVLGTDYADTQFPDELS
LNARLANEFGASVLPVVGGRKQTADSVLAETHNAFRAYDGLGCDVLAMVTNRVAREDRDE
IAERLAHRLPVPCWVVPDEPALSAPTVSQIAHALGAEIVLGDDSGLARDALDFVFGGAML
PNLLAALTPGCLVITPGDRADLVIGTLAAHSAGTPPIAGVLLTLNEVPGEGILTLAARLA
PGTPVLSVTGTSFPTAERLFSLEGKLGAATPRKAETALGLFERYVDTAELNKRVSAPSSD
RVTPMMFEHKLLEQARSDLRRVVLPEGTEERVLHAAEVLLRRGVCELTLLGPVEQIRKKA
ADLGIDLGGAELIDPAASELRDSFAEKYAALRAHKGVTVELAYDVVSDVNYFGTLMVQEG
FADGMVSGSVHSTAATIRPAFEIIKTKPDAAIVSSVFFMCLADKVLVYGDCAVNPDPDAE
QLADIATQSASTAAQFGVEPRIAMLSYSTGTSGSGADVDKVREATELVRSRRPDLSVEGP
IQYDAAVEPSVAATKLPGSAVAGQASVLIFPDLNTGNNTYKAVQRSAGAIAVGPVLQGLR
KPVNDLSRGALVQDIVNTVAITAIQAQQSPTEKASAQ
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgcagcgtgtacgtgaccggcatcgaccgcggcgacggccgccaggtcgtcgag
ctgggggtcatggaactgctgacccggcaggtcgaccgggtcggcgtcttccgtcccctg
gtgcacgacgggccggaccggctcttcgaactgctgcgcgcccgctaccggctctcgcag
gaccccgcgacggtctacggcatggactaccaggaggcctccctcctccaggcggaacag
ggcgtggacgagctggtgtccgcgctggtcgaccgcttccacctggtcgcgcgggactac
gacgtcgtcctggtcctgggcaccgactacgccgacacccagttcccggacgagctgtcc
ctgaacgcgcggctcgccaacgagttcggcgcctcggtcctccccgtcgtcgggggccgc
aagcagaccgccgactcggtgctggccgagacccacaacgccttccgtgcctacgacggc
ctcggctgcgacgtgctcgccatggtgaccaaccgggtcgcgcgcgaggaccgggacgag
atcgccgagcggctcgcgcaccggctgccggtgccgtgctgggtggtaccggacgagccc
gccctgtcggcgccgacggtctcccagatcgcgcacgccctgggcgccgagatcgtcctc
ggcgacgactccgggctcgcccgcgacgcgctggacttcgtcttcggcggggccatgctg
cccaacctgctggccgcgctgaccccgggctgcctggtcatcacgcccggcgaccgcgcc
gacctggtgatcggcacgctggccgcgcacagcgccggcaccccgccgatagccggggtg
ctgctgacgctgaacgaggtgcccggcgagggcatcctcaccctcgccgcccggctggcc
cccggcacgccggtgctctcggtgacgggcaccagctttcccaccgcggaacggctcttc
tccctggagggcaagctgggcgcggccaccccgcgcaaggcggagaccgccctcggcctc
ttcgagcggtacgtcgacaccgccgagctgaacaagcgggtctccgcgcccagcagcgac
cgcgtcacgccgatgatgttcgagcacaagctgctcgaacaggcccgctccgacctgcgc
cgggtcgtcctgccggagggcaccgaggagcgggtgctgcacgcggcggaggtgctgctg
cggcgcggggtgtgcgagctgacccttctcggccccgtcgagcagatccgcaagaaggcc
gccgacctcggcatcgacctcggcggcgccgagctgatcgacccggccgccagcgagctg
cgcgactccttcgccgagaagtacgccgccctgcgcgcccacaagggcgtgaccgtggag
ctggcgtacgacgtggtctcggacgtgaactacttcggcacgctgatggtgcaggagggg
ttcgccgacggcatggtgtcggggtcggtgcactcgacggcggcgaccatccggcccgcc
ttcgagatcatcaagaccaagccggacgcggccatcgtctcctccgtcttcttcatgtgc
ctggccgacaaggtgctggtctacggcgactgcgcggtcaacccggacccggacgcggag
cagctcgccgacatcgcgacgcagtccgcctcgaccgccgcgcagttcggggtggagccg
cggatcgcgatgctgtcgtactcgaccggcacgtccggttccggcgcggacgtcgacaag
gtccgcgaggccaccgagctggtccgctcgcgccgcccggacctcagcgtcgaggggccg
atccagtacgacgcggcggtcgagccgtcggtcgccgcgaccaagctgcccggctccgcg
gtcgccgggcaggccagcgtgctgatcttccccgacctgaacaccggcaacaacacctac
aaggcggtgcagcgctcggccggcgccatcgcggtcggcccggtgctccagggcctgcgc
aagccggtcaacgacctgtcccggggcgcgctcgtgcaggacatcgtcaacaccgtcgcc
atcacggcgatccaggcccagcagtccccgaccgagaaggcgtccgcccagtga

DBGET integrated database retrieval system