KEGG   Streptomyces coelicolor: SCO5470Help
Entry
SCO5470           CDS       T00085                                 

Gene name
glyA
Definition
(RefSeq) serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00460  Cyanoamino acid metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco00670  One carbon pool by folate
sco00680  Methane metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO5470 (glyA)
  09102 Energy metabolism
   00680 Methane metabolism
    SCO5470 (glyA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO5470 (glyA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SCO5470 (glyA)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SCO5470 (glyA)
Enzymes [BR:sco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     SCO5470 (glyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHMT Aminotran_1_2 Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 1100910
NCBI-ProteinID: NP_629606
Kitasato: SCO5470
UniProt: O86565
Position
complement(5955947..5957209)
Genome map
AA seq 420 aa AA seqDB search
MSLLNTPLHELDPDVAAAVDAELDRQQSTLEMIASENFAPVAVMEAQGSVLTNKYAEGYP
GRRYYGGCEHVDVVEQIAIDRVKALFGAEHANVQPHSGAQANAAAMFALLKPGDTIMGLN
LAHGGHLTHGMKINFSGKLYNVVPYHVGDDGQVDMAEVERLAKETKPKLIVAGWSAYPRQ
LDFAAFRKVADEVGAYLMVDMAHFAGLVAAGLHPNPVPHAHVVTTTTHKTLGGPRGGVIL
STAELAKKINSAVFPGQQGGPLEHVVAAKAVAFKVAASEDFKERQGRTLEGARILAERLV
RDDAKAAGVSVLTGGTDVHLVLVDLRDSELDGQQAEDRLHEVGITVNRNAVPNDPRPPMV
TSGLRIGTPALATRGFTAEDFAEVADVIAEALKPSYDAEALKARVKTLADKHPLYPGLNK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttctgaacacacccctgcacgagctggacccggacgtcgccgccgccgtcgac
gccgagctggaccgccagcagtccaccctcgagatgatcgcgtcggagaacttcgccccg
gtcgcggtcatggaggcccagggctcggtcctcaccaacaagtacgccgagggctacccc
ggccgccgctactacggcggctgcgagcacgtcgacgtggtcgagcagatcgccatcgac
cgggtcaaggcgctcttcggcgccgagcacgccaacgtgcagccgcactcgggcgcccag
gccaacgcggccgcgatgttcgcgctgctcaagcccggcgacacgatcatgggtctgaac
ctcgcgcacggcgggcacctgacccacggcatgaagatcaacttctccggcaagctctac
aacgtggtcccctaccacgtcggcgacgacggccaggtcgacatggccgaggtggagcgc
ctggccaaggagaccaagccgaagctgatcgtggcgggctggtcggcctacccgcgtcag
ctggacttcgccgcgttccgcaaggtcgcggacgaggtcggcgcgtacctgatggtcgac
atggcgcacttcgccggtctggtcgcggcgggcctgcacccgaacccggtcccgcacgcc
cacgtcgtcaccacgaccacccacaagacgctgggcggtccgcgcggcggtgtgatcctc
tccacggccgagctggccaagaagatcaactccgccgtcttccccggtcagcagggtggc
ccgctggagcacgtggtggccgccaaggccgtcgccttcaaggtcgccgcgagcgaggac
ttcaaggagcgccagggccgtacgctggagggtgcccgcatcctggccgagcgcctggtg
cgggacgacgcgaaggccgcgggcgtctccgtcctgaccggcggcacggacgtccacctg
gtcctggtggacctgcgcgactccgagctggacggacagcaggccgaggaccgcctccac
gaggtcggcatcacggtcaaccgcaacgccgtcccgaacgacccgcgcccgccgatggtg
acctccggtctgcgcatcggtacgccggccctggcgacccgcggcttcaccgccgaggac
ttcgccgaggtcgcggacgtgatcgccgaggcgctgaagccgtcctacgacgcggaggcc
ctcaaggcccgggtgaagaccctggccgacaagcacccgctgtacccgggtctgaacaag
tag

DBGET integrated database retrieval system