KEGG   Streptomyces coelicolor: SCO5472Help
Entry
SCO5472           CDS       T00085                                 

Gene name
gcvT
Definition
(RefSeq) glycine cleavage system aminomethyltransferase T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco00670  One carbon pool by folate
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO5472 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO5472 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SCO5472 (gcvT)
Enzymes [BR:sco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     SCO5472 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-GeneID: 1100912
NCBI-ProteinID: NP_629608
Kitasato: SCO5472
UniProt: O86567
Position
complement(5957728..5958846)
Genome map
AA seq 372 aa AA seqDB search
MSSTELRRTALDATHRALGATMTDFAGWDMPLRYGSEREEHVAVRTRAGLFDLSHMGEIT
VTGPQAAELLNFALVGNIGTVKPGRARYTMICREDGGILDDLIVYRLEEAEYMVVANASN
AQVVLDALTERAAGFDAEVRDDRDAYALLAVQGPESPGILASLTDADLDGLKYYAGLPGT
VAGVPALIARTGYTGEDGFELFVKPEHAVGLWQALTGAGEAAGLIPCGLSCRDTLRLEAG
MPLYGNELSTALTPFDAGLGRVVKFEKEGDFVGRAALTEAAERAASRPPRVLVGLVAEGR
RVPRSGYRVVAGGEVIGEVTSGAPSPTLGRPIAMAYVDPAHAAPGTEGVGVDIRGSHEPY
EVVALPFYKRQK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtaccgaactgcgccgtaccgcgctcgatgccacgcatcgcgcgctgggcgcg
acgatgaccgacttcgccggctgggacatgccgctgcgctacggctccgagcgcgaggag
cacgtcgcggtgcgcacccgcgccggtctcttcgacctgtcgcacatgggtgagatcacc
gtcaccggcccgcaggcggccgagctgctgaacttcgcgctggtcggcaacatcggcacc
gtgaagccgggccgggcgcgctacaccatgatctgccgcgaggacggcggcatcctggac
gacctgatcgtctatcggctcgaagaggccgagtacatggtcgtcgccaacgcctccaac
gcccaggtcgtcctggacgcgctgaccgagcgggcggccgggttcgacgccgaggtgcgc
gacgaccgggacgcctacgcgctgctcgccgtgcagggccccgagtccccgggcatcctc
gcgtcgctcaccgacgccgatctggacggcctgaagtactacgccggtctgcccggaacg
gtcgccggcgtcccggcgctgatcgcgcgcaccggctacaccggcgaggacggcttcgag
ctgttcgtgaagccggagcacgccgtcgggctgtggcaggcactgaccggggcgggcgag
gccgcggggctgatcccgtgcggtctgtcctgccgggacacgctccgcctggaggcgggc
atgccgctgtacggcaacgagctgtcgaccgcgctgacgccgttcgacgccggtctgggc
cgggtggtgaagttcgagaaggagggcgacttcgtcgggcgcgccgcgctgaccgaggcc
gccgagcgcgccgcttcccggccgccccgcgtcctggtcggcctggtcgccgagggccgc
cgggtcccgcgctccgggtaccgggtcgtcgcgggcggcgaggtgatcggcgaggtcacc
tccggcgctccgtccccgacgctgggcaggccgatcgccatggcgtacgtcgaccccgca
cacgcggccccgggcaccgagggcgtgggcgtggacatccggggcagccacgagccgtac
gaggtcgtggcgctgccgttctacaagcgccagaagtag

DBGET integrated database retrieval system