KEGG   Streptomyces coelicolor: SCO5512Help
Entry
SCO5512           CDS       T00085                                 

Gene name
ilvB, SC8D9.24
Definition
(RefSeq) acetolactate synthase 1 catalytic subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
sco  Streptomyces coelicolor
Pathway
sco00290  Valine, leucine and isoleucine biosynthesis
sco00650  Butanoate metabolism
sco00660  C5-Branched dibasic acid metabolism
sco00770  Pantothenate and CoA biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sco_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SCO5512 (ilvB)
   00660 C5-Branched dibasic acid metabolism
    SCO5512 (ilvB)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SCO5512 (ilvB)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO5512 (ilvB)
Enzymes [BR:sco01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     SCO5512 (ilvB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh
Motif
Other DBs
NCBI-GeneID: 1100952
NCBI-ProteinID: NP_629647
Kitasato: SCO5512
UniProt: Q9Z567
Position
6003117..6004958
Genome map
AA seq 613 aa AA seqDB search
MTEQATGAHPQPRPRSGGQSAPEHVTGAQSLIRSLEEVGADTVFGIPGGTILPAYDPLMD
STRVRHVLVRHEQGAGHAATGYAQATGKVGVCMATSGPGATNLVTPIADANLDSVPLVAI
TGQVVSSAIGTDAFQEADIVGITMPITKHSFLVTKAEDIPRVIAQAFHIASTGRPGPVLV
DIPKDILQKKTTFSWPPVMDLPGYRPVTKPHAKQIREAAKLISAAKRPVLYVGGGVLKAK
ATAELKVLAELTGAPVTTTLMALGAFPDSHPLHVGMPGMHGAVTAVTALQKADLIVALGA
RFDDRVTGKLDSFAPHAKIVHADIDPAEIGKNRAADVPIVGDAREVVADLVQAVQKEHDE
GNKGDYSAWWKDLSRWRDTYPLGYDQPEDGSLSPQQVIERIGQLAPEGTIFAAGVGQHQM
WAAHFVQYEKPATWLNSGGAGTMGYAVPAAMGAQAGMPGRTVWAIDGDGCFQMTNQELTT
CALNNIPIKVAVINNGALGMVRQWQTLFYNQRYSNTVLHSGPDDVNPEARGTRVPDFVKL
SEAMGCYAIRCEDPADLDKVIEEANSVNDRPVVVDFIVHEDAMVWPMVAAGTSNDEILAA
RDVRPDFGDNEDD
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcaggccaccggggctcacccgcagccccggccccgatccggaggacagtcc
gcccccgagcacgtcacgggtgcgcagtccctcattcgctctctcgaggaggtcggcgcc
gacaccgtattcggcatccccggaggcaccatccttccggcctacgacccgctgatggac
tccaccagggtgcgccacgtcctggtccgccacgagcagggcgccggccacgcggccacc
ggctacgcgcaggccaccggcaaggtcggcgtctgcatggcgacctcgggccccggggcc
accaacctggtgaccccgatcgccgacgccaacctggactccgtgccgctggtcgcgatc
accgggcaggtggtctcctccgcgatcggcacggacgccttccaggaggcggacatcgtc
ggcatcaccatgccgatcaccaagcacagcttcctggtcaccaaggccgaggacatcccc
cgggtgatcgcgcaggcgttccacatcgcctccaccggccgccccggccccgtcctggtc
gacatccccaaggacatcctccagaagaagaccaccttctcctggccgccggtcatggac
ctgcccggctaccgcccggtcaccaagccgcacgccaagcagatccgcgaggcggccaag
ctgatctccgcggcgaagcggcccgtgctctacgtcggcggcggcgtcctcaaggcgaag
gccaccgccgagctgaaggtcctcgccgaactcaccggagcgcccgtcaccaccaccctg
atggcgctcggcgcgttccccgacagccacccgctgcacgtgggaatgccgggcatgcac
ggtgcggtcaccgccgtcaccgcgctgcagaaggccgacctgatcgtcgccctcggagcc
cgcttcgacgaccgcgtcaccggcaagctggacagcttcgccccgcacgccaagatcgtc
cacgccgacatcgacccggccgagatcggcaagaaccgcgccgccgacgtgccgatcgtc
ggcgacgcccgcgaggtcgtcgccgacctcgtgcaggccgtccagaaggagcacgacgag
ggcaacaagggcgactacagcgcctggtggaaggacctgagccgctggcgcgacacctac
cccctcggctacgaccagcccgaggacggctcgctctccccgcagcaggtcatcgagcgc
atcgggcagctggcacccgagggcacgatcttcgcggcgggcgtcggccagcaccagatg
tgggccgcgcacttcgtccagtacgaaaagcccgccacctggctgaactcgggcggcgcg
gggaccatgggctacgcggtcccggcggccatgggcgcccaggccggcatgcccggccgc
accgtctgggcgatcgacggcgacggctgcttccagatgaccaaccaggaactgaccacc
tgcgccctgaacaacatcccgatcaaggtcgccgtcatcaacaacggcgccctcgggatg
gtccgccagtggcagaccctgttctacaaccagcggtactccaacacggtgctgcactcc
ggcccggacgacgtcaacccggaggcccgcggcacccgcgtccccgacttcgtgaagctg
tcggaggccatgggctgctacgccatccgctgcgaggaccccgccgacctcgacaaggtg
atcgaggaggccaactccgtcaacgaccgccccgtcgtcgtcgacttcatcgtccacgag
gacgccatggtctggccgatggtcgccgccggcacctccaacgacgagatcctggccgcc
cgggacgtccgccccgacttcggcgacaacgaagacgactga

DBGET integrated database retrieval system