KEGG   Streptomyces coelicolor: SCO5515Help
Entry
SCO5515           CDS       T00085                                 

Gene name
SC8D9.27, serA
Definition
(RefSeq) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00680  Methane metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    SCO5515 (SC8D9.27)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO5515 (SC8D9.27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO5515 (SC8D9.27)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     SCO5515 (SC8D9.27)
    1.1.1.399  2-oxoglutarate reductase
     SCO5515 (SC8D9.27)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO5515 (SC8D9.27)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2 IlvN 3HCDH_N AdoHcyase_NAD UDPG_MGDP_dh_C
Motif
Other DBs
NCBI-GeneID: 1100955
NCBI-ProteinID: NP_629650
Kitasato: SCO5515
UniProt: Q9Z564
Position
6006860..6008449
Genome map
AA seq 529 aa AA seqDB search
MSSKPVVLIAEELSPATVDALGPDFEIRHCNGADRAELLPAIADVDAILVRSATKVDAEA
VAAAKKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLIVATARNIPQ
ANAALKNGEWKRSKYTGVELAEKTLGVVGLGRIGALVAQRMSAFGMKVVAYDPYVQPARA
AQMGVKVLSLDELLEVSDFITVHLPKTPETLGLIGDEALRKVKPSVRIVNAARGGIVDEE
ALYSALKEGRVAGAGLDVYAKEPCTDSPLFEFDQVVATPHLGASTDEAQEKAGIAVAKSV
RLALAGELVPDAVNVQGGVIAEDVKPGLPLAERLGRIFTALAGEVAVRLDVEVYGEITQH
DVKVLELSALKGVFEDVVDETVSYVNAPLFAQERGVEVRLTTSSESPEHRNVVIVRGTLS
DGEEVSVSGTLAGPKHLQKIVAIGEYDVDLALADHMVVLRYEDRPGVVGTVGRIIGEAGL
NIAGMQVARATVGGEALAVLTVDDTVPSGVLAEVAAEIGATSARSVNLV
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgagctcgaaacccgtcgtactcatcgctgaagagctgtcgcccgcgaccgtggacgca
ctcggccccgacttcgagatccgccactgcaacggcgcggaccgggccgaactgctcccc
gccatcgccgacgtggacgcgatcctggtccgctccgcgaccaaggtcgacgccgaggcc
gtggccgccgccaagaagctcaaggtcgtcgcgcgcgccggggtcggcctggacaacgtc
gacgtctccgccgccaccaaggccggcgtgatggtggtcaacgccccgacctccaacatc
gtcaccgccgccgagctggcctgcggcctgatcgtcgccaccgcccgcaacatcccgcag
gccaacgccgcgctgaagaacggcgagtggaagcgcagcaagtacaccggcgtggagctg
gccgagaagaccctcggcgtcgtcggcctcggccgcatcggcgcgctcgtcgcgcagcgc
atgtcggccttcggcatgaaggtcgtcgcctacgacccctacgtgcagcccgcgcgggcc
gcgcagatgggcgtcaaggtgctgtccctggacgagctgctggaggtctccgacttcatc
acggtccacctgcccaagacccccgagaccctcggcctgatcggcgacgaggcgctgcgc
aaggtcaagccgagcgtccgcatcgtcaacgccgcgcgcggcggcatcgtcgacgaggag
gcgctgtactcggcgctcaaggagggccgcgtcgccggcgccggcctcgacgtgtacgcc
aaggagccctgcaccgactcgccgctgttcgagttcgaccaggtggtcgccaccccgcac
ctcggcgcctccaccgacgaggcccaggagaaggccggcatcgccgtcgccaagtcggtc
cgcctggccctcgccggtgagctggtccccgacgcggtcaacgtccagggcggtgtcatc
gccgaggacgtcaagcccggtctgccgctcgccgagcgcctcggccgcatcttcaccgcg
ctcgcgggtgaggtcgccgtccgcctcgacgtcgaggtctacggcgagatcacccagcac
gacgtgaaggtgctggagctgtccgccctcaagggcgtcttcgaggacgtcgtcgacgag
acggtgtcgtacgtcaacgccccgctgttcgcccaggagcgcggcgtcgaggtccggctg
accaccagctcggagtccccggagcaccgcaacgtcgtcatcgtgcgcggcaccctctcg
gacggcgaggaggtgtcggtctccggcacgctggccggcccgaagcacctccagaagatc
gtcgccatcggcgagtacgacgtggacctcgccctcgccgaccacatggtcgtcctgcgc
tacgaggaccgtcccggcgtcgtcggcaccgtcggccggatcatcggcgaggcgggtctc
aacatcgccggcatgcaggtcgcccgcgcgacggtcggcggcgaggcgctggccgtcctc
accgtcgacgacacggtgccctccggggttctggcggaggtcgcggcggagatcggcgcc
acgtccgcccggtccgtcaacctcgtctga

DBGET integrated database retrieval system