KEGG   Streptomyces coelicolor: SCO5523Help
Entry
SCO5523           CDS       T00085                                 

Gene name
ilvE
Definition
(RefSeq) branched-chain amino acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
sco  Streptomyces coelicolor
Pathway
sco00270  Cysteine and methionine metabolism
sco00280  Valine, leucine and isoleucine degradation
sco00290  Valine, leucine and isoleucine biosynthesis
sco00770  Pantothenate and CoA biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sco_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
sco_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO5523 (ilvE)
   00280 Valine, leucine and isoleucine degradation
    SCO5523 (ilvE)
   00290 Valine, leucine and isoleucine biosynthesis
    SCO5523 (ilvE)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO5523 (ilvE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sco01007]
    SCO5523 (ilvE)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     SCO5523 (ilvE)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class IV
   SCO5523 (ilvE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-GeneID: 1100963
NCBI-ProteinID: NP_629657
Kitasato: SCO5523
UniProt: O86505
Position
6016567..6017655
Genome map
AA seq 362 aa AA seqDB search
MTTPTIELKPSAHPLSDSERAAILANPGFGRHFTDHMVTIKWTEGRGWHDGQLVPYAPLS
LDPATMVLHYAQEIFEGLKAYRRPDGSVATFRPEKNGARFQASSRRLGMPELPVDTFIEA
CDALVAQDEKWVPAHGGEESLYLRPFMIATEVGLGVRPANEYLFIVIASPAGAYFPGGVK
PVSIWVSEDRVRAVPGGMGDAKTGGNYAASLLAQAEAAAKGCDQVCYLDAIERKWVEELG
GMNLYFVYGNKIVTPSLTGSILEGVTRDSLLTVARDLGYEAEEGRVSVDQWQRDSENGTL
TEVFACGTAAVITPVGTVKRAGAQWQQSGGETGEVTQRLRDALLDIQRGTVADPHGWMHT
LA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcccacgatcgagctcaagccctctgcccacccgctctcggactccgagcgc
gcggcgattctggccaaccccgggttcggccgccacttcaccgaccacatggtgacgatc
aagtggaccgagggccgcggctggcacgacggccagctggtgccgtacgccccgctctcc
ctcgacccggccaccatggtcctgcactacgcgcaggagatcttcgagggcctgaaggcc
taccggcggcccgacggctccgtcgccaccttccgcccggagaagaacggcgcccgcttc
caggcgtcctcgcgccgcctgggcatgcccgagcttcccgtggacaccttcatcgaggcc
tgcgacgcgctggtcgcgcaggacgagaagtgggtgccggcgcacggcggcgaggagtcc
ctgtacctgcgccccttcatgatcgcgaccgaggtcggcctgggcgtcaggccggccaac
gagtacctcttcatcgtcatcgcctccccggccggcgcctacttcccgggcggggtcaag
ccggtctccatctgggtctccgaggaccgcgtccgcgccgtccccggcggcatgggcgac
gccaagaccggcggcaactacgcggcctccctgctcgcccaggccgaggccgccgccaag
ggctgcgaccaggtctgctacctcgacgccatcgagcgcaagtgggtcgaggaactgggc
ggcatgaacctgtacttcgtgtacggcaacaagatcgtcacgccctccctcaccggctcc
atcctggagggcgtcacccgcgactccctgctcaccgtcgcccgcgacctcggttacgag
gccgaggagggccgcgtctcggtcgaccagtggcagcgcgactcggagaacggcaccctc
accgaggtcttcgcctgcggcaccgcggccgtgatcacccccgtcggcacggtcaagcgg
gccggcgcgcagtggcagcagagcgggggcgagacgggtgaggtgacgcagcggctgcgg
gacgcgctgctcgacattcagcgcgggacggtcgccgacccgcacgggtggatgcacacg
ctggcctga

DBGET integrated database retrieval system