KEGG   Streptomyces coelicolor: SCO5525Help
Entry
SCO5525           CDS       T00085                                 

Gene name
ureAB
Definition
(RefSeq) bifunctional urease subunit gamma/beta
  KO
K14048  urease subunit gamma/beta [EC:3.5.1.5]
Organism
sco  Streptomyces coelicolor
Pathway
sco00220  Arginine biosynthesis
sco00230  Purine metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO5525 (ureAB)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SCO5525 (ureAB)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    SCO5525 (ureAB)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     SCO5525 (ureAB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Urease_gamma Urease_beta
Motif
Other DBs
NCBI-GeneID: 1100965
NCBI-ProteinID: NP_629659
Kitasato: SCO5525
UniProt: O86507
Position
6019304..6019987
Genome map
AA seq 227 aa AA seqDB search
MRLTPTERDRLLLFGAAELARARRARGLRLNVPEATALIADTVCEAARDGARLAQAIERA
RSVLGPDDVLPGVADVVTEVHVEAVFDDGSRLAVVADPVGGGGLGDDAPGALLPGHDRPE
PEAALRLPVTNTATVPVSVTSHFHFFEANPRLDFDRGRAYGMRLAVPAGSSVRFGPGERV
EVGLVPIGGARVAIGFAGLVDGPLDAPGAREEALRRAAACGYLGADR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgagactgacccccacggaacgtgaccggctgctgctgttcggggcggccgagctggcc
cgcgcccgacgggcccgcgggctcaggctgaacgtgccggaggcgaccgcgctgatcgcg
gacaccgtgtgcgaggccgcccgcgacggagcgcgcctcgcgcaggccatcgagcgtgcc
cggtccgtgctcggcccggacgacgtcctgcccggcgtcgccgacgtggtcaccgaggtg
cacgtggaggccgtcttcgacgacggctcccgcctcgcggtcgtcgccgatcccgtcgga
ggcggcgggctcggcgacgacgcccccggggcgctgctgccggggcacgaccgtcccgag
cccgaggcggcgctgcggctcccggtcaccaacaccgcgaccgtgccggtctccgtcacc
tcccacttccacttcttcgaggccaatccgcgcctggacttcgaccgtgggcgcgcctac
ggcatgcgcctggccgtcccggccggctcctcggtccgcttcggccccggcgagcgcgtc
gaggtggggctcgtgccgatcggcggagcacgcgtcgccatcgggttcgccgggctcgtc
gacggcccgctggacgcgccgggagccagggaagaggccctgcgccgggccgccgcctgc
ggatacctgggggcagaccgatga

DBGET integrated database retrieval system