KEGG   Streptomyces coelicolor: SCO5526Help
Entry
SCO5526           CDS       T00085                                 

Gene name
ureC
Definition
(RefSeq) urease subunit alpha
  KO
K01428  urease subunit alpha [EC:3.5.1.5]
Organism
sco  Streptomyces coelicolor
Pathway
sco00220  Arginine biosynthesis
sco00230  Purine metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO5526 (ureC)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SCO5526 (ureC)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    SCO5526 (ureC)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     SCO5526 (ureC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Urease_alpha Amidohydro_3 Amidohydro_2
Motif
Other DBs
NCBI-GeneID: 1100966
NCBI-ProteinID: NP_629660
Kitasato: SCO5526
UniProt: O86508
Position
6019984..6021660
Genome map
AA seq 558 aa AA seqDB search
MTIDPYAYAAAHGPRAGDRLRLGDSGLVIRVESDAQHYGDEFLAGFGKTARDGLHLKAAA
VRDTCDVVISNVVVIDAVQGIRKVSIGIREGRVHAIGRAGNPDTLDGVDVVVGTGTSIVS
GEGLIATAGAVDTHVHLLSPRIMEASLASGVTTIIGQEFGPVWGVGVNSPWALKHAFGAF
DAWPVNIGFLGRGSSSHEAPLIEALAEGGASGFKVHEDMGAHTRALDTALRVAEEHDVQV
ALHSDGLNECLSVEDTLRVLDGRTIHAFHIEGCGGGHVPNVLKMAGVPHVIGSSTNPTLP
FGRDAVAEHYGMIVSVHDLKTDLPGDAAMARDRIRAGTMGAEDVLHDLGAIGITSSDAQG
MGRAGETVRRTFAMAGKMKAQFGAEGDDDNARVLRYIAKLTINPALAHGLAHEVGSIEVG
KLADLVLWRPDHFGAKPQLVLKSGFPAYGVVGDPNAATDTCEPLVLGPQFGAHGATPAEI
SVAFVAQAALDQGGDTMPTRRRRVAVRGTRGIGPADLRLNSRTGAVDVDQRTGLVTLDGD
PLRSEPAESVSLNRLYFL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgacccgtacgcctacgccgccgcccacggcccgcgcgccggcgaccggctc
cgcctcggcgactcggggctggtgatccgcgtcgagtccgacgcgcagcactacggcgac
gagttcctcgccggcttcggcaagaccgcccgggacggactgcacctcaaggccgccgcc
gtccgcgacacctgcgacgtcgtgatcagcaacgtggtcgtgatcgacgccgtgcagggc
atccggaaggtgtcgatcggcatccgcgaggggcgcgtccacgccatcggccgggccggg
aacccggacaccctcgacggcgtcgacgtcgtggtcggcaccggcacctccatcgtgtcc
ggggaggggctcatcgccaccgccggggccgtggacacccacgtccacctgctctccccg
cggatcatggaggcctcgctcgcgtccggcgtgacgacgatcatcgggcaggagttcggc
cccgtgtggggcgtcggcgtcaactcgccctgggcactgaagcacgcgttcggcgccttc
gacgcctggccggtgaacatcggcttcctcggccggggctcctcgtcccacgaggccccg
ctgatcgaggcgctggccgagggcggcgcatccggcttcaaggtgcacgaggacatgggc
gcccacacccgcgccctcgacaccgcgctgcgcgtcgccgaggagcacgacgtccaggtc
gccctgcacagcgacgggctgaacgagtgcctgtccgtcgaggacaccctccgggtcctg
gacggccgcaccatccacgccttccacatcgagggctgcggcgggggacacgtccccaac
gtgctgaagatggccggtgtcccccacgtcatcggctcctccaccaaccccaccctgccc
ttcggccgggacgcggtggccgagcactacggcatgatcgtctccgtccacgacctcaag
accgacctgccgggcgacgccgccatggcccgcgaccgcatccgcgccgggaccatgggc
gccgaggacgtgctgcacgacctgggcgccatcggcatcacctcctccgacgcgcagggc
atgggccgggccggcgagaccgtccgccgtaccttcgccatggccgggaagatgaaggcg
cagttcggcgccgagggcgacgacgacaacgcacgcgtcctgcgctacatcgccaagctg
accatcaaccccgccctcgcccacggtctcgcgcacgaggtcggctccatcgaggtcggc
aagctcgccgacctcgtgctgtggcgcccggaccacttcggcgccaagccgcagctggtc
ctcaagtcgggcttcccggcgtacggcgtggtcggcgaccccaacgcggccaccgacacc
tgcgaacccctggtcctcgggccccagttcggcgcgcacggcgccacacccgccgagatc
tcggtggccttcgtcgcgcaggccgccctcgaccagggcggcgacaccatgccgacccgc
cgacgccgggtggccgtgcgcggcacccgcggcatcggaccggccgacctgcggctcaac
tcccgcaccggcgcggtcgacgtcgaccagcgcaccggcctggtcaccctcgacggcgac
ccgctgcgctccgaacccgccgagtcggtctccctcaaccgcctctacttcctctga

DBGET integrated database retrieval system