KEGG   Streptomyces coelicolor: SCO5547Help
Entry
SCO5547           CDS       T00085                                 

Gene name
gltX
Definition
(RefSeq) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
sco  Streptomyces coelicolor
Pathway
sco00860  Porphyrin and chlorophyll metabolism
sco00970  Aminoacyl-tRNA biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
Module
sco_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
sco_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SCO5547 (gltX)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SCO5547 (gltX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sco01007]
    SCO5547 (gltX)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sco03016]
    SCO5547 (gltX)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:sco02048]
    SCO5547 (gltX)
Enzymes [BR:sco01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     SCO5547 (gltX)
Amino acid related enzymes [BR:sco01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SCO5547 (gltX)
Transfer RNA biogenesis [BR:sco03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SCO5547 (gltX)
 Prokaryotic Type
   Other AARSs
    SCO5547 (gltX)
Prokaryotic defense system [BR:sco02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    SCO5547 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-GeneID: 1100987
NCBI-ProteinID: NP_629681
Kitasato: SCO5547
UniProt: O86528
Position
6046263..6047747
Genome map
AA seq 494 aa AA seqDB search
MASASGSPVRVRFCPSPTGNPHVGLVRTALFNWAFARHHQGTLVFRIEDTDAARDSEESY
DQLLDSMRWLGFDWDEGPEVGGPHAPYRQSQRMDIYQDVAQKLLDAGHAYRCYCSQEELD
TRREAARAAGKPSGYDGHCRELTDAQVEEYTSQGREPIVRFRMPDEAITFTDLVRGEITY
LPENVPDYGIVRANGAPLYTLVNPVDDALMEITHVLRGEDLLSSTPRQIALYKALIELGV
AKEIPAFGHLPYVMGEGNKKLSKRDPQSSLNLYRERGFLPEGLLNYLSLLGWSLSADQDI
FTIEEMVAAFDVSDVQPNPARFDLKKCEAINGDHIRLLEVKDFTERCRPWLKAPVAPWAP
EDFDEAKWQAIAPHAQTRLKVLSEITDNVDFLFLPEPVFDEASWTKAMKEGSDALLTTAR
EKLDAADWTSPEALKEAVLAAGEAHGLKLGKAQAPVRVAVTGRTVGLPLFESLEVLGKEK
ALARIDAALARLAA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtggctagcgcatccggctcccccgtacgcgtccgtttctgtccgtcccccaccggcaac
ccccacgtgggcctggtccgcaccgccctgttcaactgggccttcgcgcgccaccaccag
ggcaccctggtcttccgcatcgaggacaccgacgccgcccgcgactccgaggagtcgtac
gaccagctgctcgactcgatgcgctggctgggcttcgactgggacgagggtcccgaggtc
ggcggcccgcacgcgccgtaccgccagtcgcagcgcatggacatctaccaggacgtcgcc
cagaagctcctggacgccggccacgcctaccgctgctactgctcccaggaggagctggac
acccgccgcgaggccgcccgcgccgccgggaagccctccggctacgacggccactgccgc
gagctgaccgacgcacaggtcgaggagtacacgtcccagggccgcgagcccatcgtccgc
ttccggatgcccgacgaggcgatcaccttcacggacctggtccgcggcgagatcacctac
ctgccggagaacgtcccggactacggcatcgtccgcgccaacggggcgcccctctacacg
ctggtcaaccccgtcgacgacgcgctgatggagatcacccacgtcctgcgcggcgaggac
ctgctctcctccaccccgcgccagatcgccctgtacaaggcgctgatcgagctgggcgtc
gccaaggagatccccgccttcggccacctgccgtacgtcatgggcgagggcaacaagaag
ctctccaagcgcgacccgcagtcgagcctcaacctctaccgcgagcgcggcttcctcccc
gagggcctgctcaactacctctccctcctcggctggtcgctctcggccgaccaggacatc
ttcacgatcgaggagatggtcgcggccttcgacgtctccgacgtccagcccaacccggcc
cgcttcgacctcaagaagtgcgaggcgatcaacggcgaccacatccgcctgctggaggtc
aaggacttcaccgagcgctgccgcccctggctgaaggcccccgtcgccccctgggcgccg
gaggacttcgacgaggccaagtggcaggcgatcgcgccgcacgcgcagacccgcctgaag
gtcctctccgagatcaccgacaacgtcgacttcctgttcctgccggagccggtcttcgac
gaggccagctggaccaaggccatgaaggagggctcggacgcgctcctgaccacggcccgc
gagaagctggacgccgccgactggacctccccggaggccctcaaggaggccgtcctggcc
gccggtgaggcccacggtctcaagctcggcaaggcccaggcccccgtccgcgtcgccgtc
accggccgcacggtcggcctgcccctcttcgagtccctggaggtcctgggcaaggagaag
gcactggcgcgcatcgacgcggcgctggcgcgactggcggcgtaa

DBGET integrated database retrieval system