KEGG   Streptomyces coelicolor: SCO5662Help
Entry
SCO5662           CDS       T00085                                 

Gene name
SC6A9.05
Definition
(RefSeq) adenosine deaminase
  KO
K18286  aminodeoxyfutalosine deaminase [EC:3.5.4.40]
Organism
sco  Streptomyces coelicolor
Pathway
sco00130  Ubiquinone and other terpenoid-quinone biosynthesis
sco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SCO5662 (SC6A9.05)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.40  aminodeoxyfutalosine deaminase
     SCO5662 (SC6A9.05)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: A_deaminase
Motif
Other DBs
NCBI-GeneID: 1101101
NCBI-ProteinID: NP_629792
Kitasato: SCO5662
UniProt: O86737
Position
complement(6161552..6162715)
Genome map
AA seq 387 aa AA seqDB search
MRPAYDDPRTTDQPITRARPPPRAARGRRLGEEPLTEHLVDPDVPRDLHAFIAGLPKAEL
HVHHVGSASPRIVSELAARHADSKVPTDPEALVDYFTFTDFAHFIDVYLSVVDLIRTPED
VRLLTYEVARDMARQQVRYAELTITPFSSTRRGIDEGAFMDAIEDARKAAEAEFGTVLRW
CFDIPGEAGLESAEETARLATDDRLRPEGLVSFGLGGPEIGVARPQFKPYFDRAIAAGLH
SVPHAGETTGPQTVWEALIDLRAERIGHGTSSAQDPKLLAHLAERRIPLEVCPTSNIATR
AVRTLDEHPIKEFVRAGVPVTINSDDPPMFGTDLNNEYAVAARLLGLDERGLADLAKNGV
EASFLDAPGKARIADEIDTYTAAWLAS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgagaccggcctacgatgatccccgaacgaccgatcagccgatcacccgtgcccgaccg
ccgccccgcgcggcccgcgggcgccgccttggggaggaacccttgaccgagcacctcgtc
gaccccgacgtcccgcgcgacctgcacgccttcatcgccggactgccgaaggccgaactg
cacgtccaccacgtcggctccgcctccccgcgcatcgtctccgaactggccgcgcgccac
gccgactccaaggtccccaccgaccccgaggccctggtcgactacttcacgttcacggac
ttcgcgcacttcatcgacgtgtacctgtccgtggtcgacctgatccgcaccccggaggac
gtccggctgctgacctacgaggtggcccgggacatggcccggcagcaggtgcggtacgcc
gagctgaccatcacgccgttctcctccacccggcgcggcatcgacgagggcgccttcatg
gacgcgatcgaggacgcccgcaaggcggccgaggcggaattcgggaccgtgctgcgctgg
tgcttcgacatcccgggcgaggccggcctggagtccgccgaggagacggcccggctcgcc
accgacgaccggctgcgcccggagggcctggtctccttcgggctcggcggacccgagatc
ggggtggcccgcccgcagttcaagccgtacttcgaccgcgcgatcgccgcgggactgcac
tcggtgccgcacgccggcgagacgaccggcccgcagaccgtgtgggaggccctcatcgac
ctgcgcgccgaacgcatcgggcacggcaccagctccgcccaggacccgaagctcctcgcc
cacctcgccgagcgccgcatcccgctggaggtgtgcccgacctcgaacatcgccacccgc
gcggtgcgcaccctggacgagcacccgatcaaggagttcgtgcgcgccggcgtcccggtg
acgatcaactccgacgacccgccgatgttcggcaccgacctcaacaacgagtacgccgtc
gccgcccgcctcctcggcctcgacgagcgcggcctcgccgacctcgcgaagaacggggtc
gaggcctccttcctcgacgcgccgggcaaggcccgcatcgccgacgagatcgacacgtac
accgccgcctggctcgcctcctga

DBGET integrated database retrieval system