KEGG   Streptomyces coelicolor: SCO5679Help
Entry
SCO5679           CDS       T00085                                 

Gene name
SC5H4.03
Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00053  Ascorbate and aldarate metabolism
sco00071  Fatty acid degradation
sco00280  Valine, leucine and isoleucine degradation
sco00310  Lysine degradation
sco00330  Arginine and proline metabolism
sco00340  Histidine metabolism
sco00380  Tryptophan metabolism
sco00410  beta-Alanine metabolism
sco00561  Glycerolipid metabolism
sco00620  Pyruvate metabolism
sco00625  Chloroalkane and chloroalkene degradation
sco00903  Limonene and pinene degradation
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO5679 (SC5H4.03)
   00053 Ascorbate and aldarate metabolism
    SCO5679 (SC5H4.03)
   00620 Pyruvate metabolism
    SCO5679 (SC5H4.03)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SCO5679 (SC5H4.03)
   00561 Glycerolipid metabolism
    SCO5679 (SC5H4.03)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO5679 (SC5H4.03)
   00310 Lysine degradation
    SCO5679 (SC5H4.03)
   00330 Arginine and proline metabolism
    SCO5679 (SC5H4.03)
   00340 Histidine metabolism
    SCO5679 (SC5H4.03)
   00380 Tryptophan metabolism
    SCO5679 (SC5H4.03)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO5679 (SC5H4.03)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCO5679 (SC5H4.03)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCO5679 (SC5H4.03)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SCO5679 (SC5H4.03)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 1101118
NCBI-ProteinID: NP_629807
Kitasato: SCO5679
UniProt: Q9KYT6
Position
6182246..6183691
Genome map
AA seq 481 aa AA seqDB search
MTSTHAFWLAGRQAAGESGFDVTSPWDGTTVGTVSLPTDAQVEEAVAAAYAVRDEFAATP
AHVRAAALDHVGRRLAERTEEIARLISAENGKPVKWARGEVGRAVSVFRFAAEEARRFNG
GEAQRLDTDAGGQGRLALTRRFPKGVVLGIAPFNFPLNLCAHKIAPAIAAGAPLILKPAP
ATPLSGLILGELLAETDLPAGSWSILPVPNDKMPALVQDERLPVISFTGSETVGYAIMDS
VPRKHCTLELGGNGAAVVLADWASDEDLDRAATRIATFSNYQGGQSCISVQRVIADAAVY
DRLLPRIVAAVEAQVTGDPNDDATDVGPLVSEAAAERVEAWVREAVDAGAKLLTGGKRDG
ASYAPTVLTELPADTTLAHEEVFGPVLSVQRVTGEAEAFAAVNDSKYGLQAGVFTHDLQA
AFRAHRALEVGGVVIGDIPSYRADQMPYGGAKQSGVGREGVKFAMDDYTYERVLVLTGLA
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgacttccacccacgccttctggctcgccggccgccaggccgccggcgagtccggcttc
gacgtcacgtccccctgggacggcaccaccgtcggcacggtgagcctgcccaccgacgcc
caggtcgaggaggcggtggccgccgcgtacgccgtacgggacgagttcgccgccaccccc
gcccacgtacgggccgccgccctcgaccacgtcggccgccgcctggccgagcgcaccgag
gagatcgcccgcctgatctccgccgagaacggcaagcccgtcaagtgggcccgcggcgag
gtcggccgcgccgtctccgtgttccgcttcgccgccgaggaggcccgccgtttcaacggc
ggcgaggcccagcgcctggacaccgacgccggcggccaggggcgcctggccctcacccgc
cgcttccccaagggcgtggtcctcggcatcgcgcccttcaacttccccctcaacctgtgc
gcccacaagatcgcccccgcgatcgccgccggcgcgcccctcatcctcaagccggccccc
gccacccccctgtccggcctgatcctcggcgaactcctcgccgagaccgacctgcccgcc
ggctcctggagcatcctcccggtcccgaacgacaagatgcccgccctcgtccaggacgag
cgcctcccggtcatctccttcaccggctccgagaccgtcggctacgcgatcatggactcg
gtgccccgcaagcactgcacgctggagctgggcggcaacggcgcggccgtcgtcctcgcc
gactgggcgagcgacgaggacctggaccgggccgcgacgcgcatcgccaccttctccaac
taccagggcggccagtcctgcatctccgtgcagcgcgtgatcgccgacgccgccgtctac
gaccgcctgctgccccgcatcgtcgccgccgtcgaggcccaggtcaccggcgacccgaac
gacgacgcgacggacgtcggcccgctggtcagcgaggccgccgccgagcgcgtggaggcc
tgggtgcgggaggccgtcgacgcgggcgcgaagctcctcaccggcggcaagcgcgacggc
gcctcctacgccccgaccgtcctcaccgagctgcccgccgacaccaccctcgcccacgag
gaggtcttcggccccgtcctcagcgtgcagcgggtgaccggtgaggccgaggccttcgcc
gccgtcaacgactccaagtacggccttcaggcaggcgtgttcacccacgacctccaggcc
gccttccgcgcccaccgcgccctggaggtcggcggcgtcgtcatcggcgacatcccctcc
taccgcgccgaccagatgccgtacggcggggccaagcagtccggagtcggccgcgagggc
gtgaagttcgcgatggacgactacacctacgagcgggtgctggtcctcaccggactcgcg
ctctga

DBGET integrated database retrieval system