KEGG   Streptomyces coelicolor: SCO5694Help
Entry
SCO5694           CDS       T00085                                 

Gene name
dxr, SC5H4.18
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sco  Streptomyces coelicolor
Pathway
sco00900  Terpenoid backbone biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
Module
sco_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCO5694 (dxr)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SCO5694 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-GeneID: 1101133
NCBI-ProteinID: NP_629822
Kitasato: SCO5694
UniProt: Q9KYS1
Position
6203922..6205178
Genome map
AA seq 418 aa AA seqDB search
MSDSPAPLADPHLVYDPVAGDGPKDVVVLGSTGSIGTQAIDLVLRNPDRFRVTALSANGG
RVALLAEQAYRLKARTVAVAREDVVPALREALTAQYGTGEPLPEILAGPEAATQLAASDC
HTVLNGITGSIGLAPTLAALEAGRTLALANKESLIVGGPLVKALAKPGQIIPVDSEHAAL
FQALAAGTRADVRKLVVTASGGPFRGRTRDELAAVTVEDALAHPTWAMGPVITINSATLV
NKGLEVIEAHLLYDIPFDRIEVVVHPQSYVHSMVEYTDGSTLAHATPPDMGGPIAVGLGW
PERVPDAAPAFDWSKASTWEFFPLDNEAFPSVDLARHVGQLAGTAPAVFNAANEECVEAF
RSGALPFLGIMETVTRVVEEHGTPRTGTSLTVADVLEAETWARARARQLAAQTAEARA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagtccagccccactcgccgacccccacctcgtctacgacccggtggcgggc
gacggcccgaaggacgtggtggtcctcgggtccaccgggtcgatcgggacccaggccatc
gacctcgtgctgcgcaacccggaccgcttccgggtcaccgccctgtccgccaacggcggc
cgggtcgccctcctcgccgagcaggcgtaccggctgaaggcgcggaccgtcgccgtcgcc
cgcgaggacgtcgtgccggcgctccgggaggcgctcaccgcccagtacggcacgggcgag
ccgctccccgagatcctcgccggaccggaggcggccacccagctcgccgcctccgactgc
cacaccgtgctcaacggcatcaccggctccatcggactcgcgcccacgctcgccgccctg
gaggcgggccgcaccctcgcgctggccaacaaggagtcgctcatcgtcggcggcccgctg
gtcaaggcgctggccaagccgggccagatcatcccggtcgactccgagcacgccgccctc
ttccaggcgctggccgccggcacccgcgccgacgtgcgcaagctggtcgtcaccgcctcc
ggcggcccgttccggggccgtaccagggacgagctggcggccgtcaccgtcgaggacgcc
ctcgcccaccccacctgggccatgggcccggtgatcacgatcaactccgcgacgctcgtc
aacaagggcctggaggtgatcgaggcccacctgctctacgacattcccttcgaccgcatt
gaggtggtcgtgcacccgcagtcgtatgtccactcgatggttgagtacacggacggatcg
accctggcccacgccacgccccccgacatgggcgggcccatcgccgtgggcctcggctgg
cccgaacgcgtccccgacgccgcccccgccttcgactggagcaaggcctcgacctgggag
ttcttcccgctcgacaacgaggccttcccctccgtcgacctggccaggcacgtcggacag
ctcgcgggcacggccccggcggtgttcaatgccgccaatgaggagtgcgtcgaggcgttc
cgctccggcgcgctgccgtttctcgggatcatggagaccgtcacgcgggtggtcgaggag
cacggcaccccccgtacgggaacctcgctcaccgtcgcggacgtcctcgaagcggagacc
tgggcacgcgcccgggcccggcaactggcggcacagacggcggaggcccgtgcatga

DBGET integrated database retrieval system