KEGG   Streptomyces coelicolor: SCO5711Help
Entry
SCO5711           CDS       T00085                                 

Gene name
ribC, ribF
Definition
(RefSeq) bifunctional riboflavin kinase/FMN adenylyltransferase
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00740  Riboflavin metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SCO5711 (ribC)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     SCO5711 (ribC)
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     SCO5711 (ribC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_syn Flavokinase CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 1101150
NCBI-ProteinID: NP_629838
Kitasato: SCO5711
UniProt: Q9Z530
Position
6225981..6226937
Genome map
AA seq 318 aa AA seqDB search
MQRWRGLEDIPEDWGRSVVTIGSYDGVHRGHQLIIRHAVDRARELGVPAVVVTFDPHPSE
VVRPGSHPPLLAPHHRRAELMADLGVDAVLILPFTKEFSKLSAADFVVKVLVDRLRAKAV
VEGPNFRFGHKAAGNVDFLIEQGKVYDFEVEVVDLYVTGDAGGGEPFSSTLTRRLVAEGD
VAGAAEILGRPHRVEGVVVRGAQRGREMGFPTANVETLPHTAIPADGVYAGWLHAQGEAM
PAAISVGTNPQFEGTERTVEAYAIDRVGLELYGLHVAVDFVAFVRGQAKFETLDALLEQM
AVDVDRCREITATDAPRP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcgctggcgtggcttggaggacatccccgaggactggggacgcagcgtcgtcacc
atcggctcctacgacggtgtccaccgcggacaccagctgatcatcaggcacgccgtggac
cgcgcccgcgagctgggcgtccccgccgtcgtcgtcaccttcgacccgcaccccagcgag
gtcgtccgccccggcagccacccgccgctgctcgccccgcaccaccgcagggccgaactg
atggcggacctgggggtggacgccgtgctgatcctccccttcaccaaggagttctcgaag
ctctccgccgccgacttcgtggtcaaggtcctggtcgaccggctgcgcgccaaggccgtc
gtcgagggccccaacttccgcttcggccacaaggccgccgggaacgtggacttcctcatc
gagcaggggaaggtctacgacttcgaggtcgaggtcgtcgacctgtacgtcaccggcgac
gcgggcggcggcgagccgttctcctccaccctgacccgccgcctggtggccgagggcgac
gtggcgggcgccgcggagatcctgggccgcccgcaccgcgtcgagggcgtcgtcgtgcgg
ggcgcccagcgcggccgcgagatgggcttccccacggccaacgtcgagacgctcccgcac
accgcgatcccggccgacggcgtctacgccggctggctgcacgcccagggcgaggcgatg
ccggccgcgatctccgtcggcaccaacccgcagttcgagggcaccgagcgcacggtcgag
gcgtacgccatcgaccgcgtgggcctcgagctgtacggcctgcacgtcgccgtggacttc
gtggccttcgtacgcggacaggcgaagttcgagacgctggacgcgctcctcgagcagatg
gccgtggacgtggacaggtgccgcgagatcaccgcgacggacgcccccaggccctga

DBGET integrated database retrieval system