KEGG   Streptomyces coelicolor: SCO5739Help
Entry
SCO5739           CDS       T00085                                 

Gene name
dapB
Definition
(RefSeq) 4-hydroxy-tetrahydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
sco  Streptomyces coelicolor
Pathway
sco00261  Monobactam biosynthesis
sco00300  Lysine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SCO5739 (dapB)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO5739 (dapB)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     SCO5739 (dapB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapB_C DapB_N Sacchrp_dh_NADP Semialdhyde_dh DXP_reductoisom
Motif
Other DBs
NCBI-GeneID: 1101178
NCBI-ProteinID: NP_629864
Kitasato: SCO5739
UniProt: O86836
Position
6263394..6264146
Genome map
AA seq 250 aa AA seqDB search
MSKLRVAVLGAKGRIGSEAVRAVEAAEDMELVAALGRGDGLEALAESGAQVAVELTTPAS
VMDNLDYCLRHGIHAVVGTTGWTDERLARLNAWLDASPGTGVLIAPNFSIGAVLTMKFAQ
IAAPYFESVEVVELHHPNKVDAPSGTATRTAQLIAQARQKAGSAPAPDATATALDGARGA
NVDGVPVHAVRLRGLLAHQEVLLGAEGETLTVRHDSLHHSSFMPGILLGARRVVTTPGLT
FGLEHFLDLN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctgcgcgtggccgtcctcggcgccaagggccggatcggctccgaggcggta
cgggcggtcgaggccgccgaggacatggagctggtcgcggccctgggccggggcgacggc
ctggaggccctggccgagtccggcgcccaggtcgccgtcgagctgaccacccccgcctcg
gtgatggacaacctcgactactgcctgcgccacggcatccacgccgtcgtcggcaccacc
ggctggaccgacgagcgcctcgcacggctgaacgcgtggctcgacgcctccccggggacc
ggcgtgctcatcgcgccgaacttctccatcggcgccgtgctgaccatgaagttcgcgcag
atcgcggccccgtacttcgagtccgtcgaggtcgtcgagctgcaccacccgaacaaggtg
gacgcccccagcggcaccgccacccgcaccgcccagctgatcgctcaggcccggcagaag
gcaggctccgcaccggcgcccgacgccactgccaccgccctggacggcgcccgcggcgcg
aacgtcgacggggtcccggtgcacgcggtccggctgcgcggcctgctcgcccaccaggag
gtcctgctcggcgccgagggcgagaccctcaccgtccggcacgactccctgcaccacagc
agcttcatgccgggcatcctgctgggcgcccgccgggtggtcaccaccccgggcctcacc
ttcggcctggaacacttcctggacctgaactga

DBGET integrated database retrieval system