KEGG   Streptomyces coelicolor: SCO5744Help
Entry
SCO5744           CDS       T00085                                 

Gene name
dapA
Definition
(RefSeq) 4-hydroxy-tetrahydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
sco  Streptomyces coelicolor
Pathway
sco00261  Monobactam biosynthesis
sco00300  Lysine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SCO5744 (dapA)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO5744 (dapA)
Enzymes [BR:sco01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     SCO5744 (dapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS Amidohydro_2
Motif
Other DBs
NCBI-GeneID: 1101183
NCBI-ProteinID: NP_629869
Kitasato: SCO5744
UniProt: O86841
Position
6266753..6267652
Genome map
AA seq 299 aa AA seqDB search
MAPTSTPQTPFGRVLTAMVTPFTADGALDLDGAQRLAAHLVDAGNDGLIINGTTGESPTT
SDAEKADLVRAVVEAVGDRAHVVAGVGTNNTQHSIELARAAERVGAHGLLLVTPYYNKPP
QEGLYLHFTAIADAAGLPVMLYDIPGRSGVPINTETLVRLAEHPRIVANKDAKGDLGRAS
WAIARSGLAWYSGDDMLNLPLLAVGAVGFVSVVGHVVTPELRAMVDAHVAGDVQKALEIH
QKLLPVFTGMFRTQGVMTTKGALALQGLPAGPLRAPMVGLTPEETEQLKIDLAAGGVQL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggctccgacctccactccgcagacccccttcgggcgggtcctcaccgccatggtcacg
cccttcacggcggacggcgcactcgacctcgacggcgcccagcggctcgccgcccacctg
gtggacgcaggcaacgacggcctgatcatcaacggcaccaccggcgagtccccgaccacc
agcgacgcggagaaagcggacctcgtacgggccgtcgtggaggcggtcggcgaccgggcg
cacgtggtggccggagtcggcaccaacaacacccagcacagcatcgagctggcccgcgcc
gccgagcgcgtcggcgcccacggcctgctgctcgtcacgccgtactacaacaagcccccg
caggagggcctgtacctgcacttcacggccatcgccgacgccgccgggctgccggtcatg
ctctacgacatccccggccgcagcggcgtcccgatcaacaccgagaccctggtccgcctc
gcggagcacccgcggatcgtcgccaacaaggacgccaagggcgacctcggccgggccagc
tgggccatcgcgcgctccggcctcgcctggtactccggcgacgacatgctcaacctgccg
ctgctcgccgtgggcgcggtcggcttcgtctccgtcgtgggccacgtcgtcaccccggag
ctgcgcgccatggtggacgcgcacgtcgccggtgacgtacagaaggccctggagatccac
cagaagctgctccccgtcttcaccggcatgttccgcacccagggcgtcatgaccaccaag
ggcgcgctcgccctccagggactgcccgcgggaccgctgcgcgcccccatggtcggcctc
acgcccgaggaaaccgagcagctcaagatcgatcttgccgccggcggggtacagctctga

DBGET integrated database retrieval system