KEGG   Streptomyces coelicolor: SCO5777Help
Entry
SCO5777           CDS       T00085                                 

Gene name
gluA
Definition
(RefSeq) glutamate uptake system ATP-binding protein
  KO
K10008  glutamate transport system ATP-binding protein [EC:3.6.3.-]
Organism
sco  Streptomyces coelicolor
Pathway
sco02010  ABC transporters
Module
sco_M00233  Glutamate transport system
Brite
KEGG Orthology (KO) [BR:sco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SCO5777 (gluA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sco02000]
    SCO5777 (gluA)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     SCO5777 (gluA)
Transporters [BR:sco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate transporter [MD:M00233] [OT]
    SCO5777 (gluA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_13 AAA_16 ABC_ATPase AAA_29 AAA_15 RsgA_GTPase AAA_18 AAA AAA_30 AAA_33 ATP_bind_1 AAA_25 IstB_IS21 AAA_24 SbcCD_C ATPase_2 AAA_23 Cytidylate_kin DEAD AAA_28 T2SSE PduV-EutP AAA_5 MMR_HSR1 NACHT NB-ARC RNA_helicase AAA_14 ATPase APS_kinase AAA_7 cobW G-alpha
Motif
Other DBs
NCBI-GeneID: 1101219
NCBI-ProteinID: NP_629902
Kitasato: SCO5777
UniProt: O50495
Position
complement(6314572..6315348)
Genome map
AA seq 258 aa AA seqDB search
MTEVSVAKEDKAATGELVVLKSVNKHFGALHVLQDIDLTIQRGEVVVVIGPSGSGKSTLC
RTINRLETVDDGSITIDGKPLPAEGKELARLRADVGMVFQSFNLFAHKTVLENVTLGQVK
VRKVDAKKAEEKARALLDRVGVGAQADKYPAQLSGGQQQRVAIARALAMDPKVMLFDEPT
SALDPEMINEVLEVMKQLAEDGMTMIVVTHEMGFARSAANRVVFMADGRIVEEATPDQFF
SNPRSDRAKDFLSKILHH
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagtatcggtggccaaggaagacaaggctgcgaccggcgaactggtcgtcctg
aagagtgtcaacaagcacttcggcgcgttgcacgtgctccaggacattgacctgacgatt
cagcgcggcgaggtcgtcgtggtcatcggaccctccgggtccggcaagtccaccctgtgc
cgcaccatcaaccggctggagaccgtcgacgacggttcgatcacgatcgacggcaagccg
ctgcccgccgagggcaaggagctggccaggctgcgggccgacgtcggcatggtcttccag
tcgttcaacctcttcgcgcacaagacggtgctcgagaacgtgaccctgggccaggtcaag
gtccgcaaggtcgacgccaagaaggccgaggagaaggcccgcgccctgctcgaccgggtc
ggcgtgggcgcgcaggcggacaagtaccccgcgcagctgtccggcggccagcagcagcgt
gtcgccatcgcgcgtgcgctggccatggacccgaaggtcatgctcttcgacgagccgacg
tcggccctcgacccggagatgatcaacgaggtcctcgaggtcatgaagcagctcgccgag
gacgggatgaccatgatcgtggtcacgcacgagatgggcttcgcccgctcggccgccaac
cgcgtggtgttcatggcggacggccgcatcgtcgaagaggccacgccggaccagttcttc
agcaatccgcgcagcgaccgtgccaaggacttcctgtcgaagatcctgcaccactga

DBGET integrated database retrieval system