KEGG   Streptomyces coelicolor: SCO5832Help
Entry
SCO5832           CDS       T00085                                 

Definition
(RefSeq) citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00020  Citrate cycle (TCA cycle)
sco00630  Glyoxylate and dicarboxylate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
sco_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO5832
   00630 Glyoxylate and dicarboxylate metabolism
    SCO5832
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     SCO5832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt CPSase_C
Motif
Other DBs
NCBI-GeneID: 1101274
NCBI-ProteinID: NP_629955
Kitasato: SCO5832
UniProt: O70008
Position
6382802..6383974
Genome map
AA seq 390 aa AA seqDB search
MSVNRTAAAATPVEVPRGLAGVVVADTEVGDVRGLEGFYHYRQYSAVELARSRGFEDVWH
LLVHGELPDARTGAAFAAETAALRRLPDAVRAALPAIAEAGAGSGPLAGMRTGLSLLGAA
LGFRPVYDLSVDQRRQDTLVAAAAVPTLLTALHRLGRGLEPVEPREDLSYAANYLYMLTG
QEPDEACTRAIEQYLISTIDHGFNASTFTARVIASTGADVAACLAGAVSALSGPLHGGAP
SRALDTLDAIGTPDRIDAWIRERVLAGDRIMGFGHAVYRTEDPRSRMLREVAQSFGGPRV
EFAVEVERQVEAILAELKPGRELHTNVEFYAGVVMELCGLPREMFTPTFAAARVVGWSAN
ILEQASDSKIIRPAARYVGPGAPVGVPAVA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcaacagaaccgcagccgcggcaacgcccgtcgaggtgccgcgcgggctcgcc
ggtgtcgtggtggccgacaccgaggtcggcgacgtgcgaggactcgaggggttctaccac
taccgccagtactcggccgtcgaactcgcccggagtcgcggcttcgaggacgtctggcat
ctcctggtccacggggaactccccgacgcgcgcaccggggccgccttcgccgccgagacc
gccgcgctgcggcggctccccgacgcggtgcgcgccgccctgcccgccatcgccgaggcc
ggcgcaggctccggcccgctcgccggcatgcgcaccggtctgtccctgctgggtgcggcc
ctgggcttccgaccggtgtacgacctgtcggtcgaccagcgccggcaggacaccctggtg
gcggccgcggccgtaccgacgctgctgaccgcgctgcaccggttgggacggggactcgag
ccggtggagccgcgcgaggacctctcgtacgccgcgaactacctgtacatgttgaccggc
caggagccggacgaggcgtgcacacgggcgatcgagcagtacctgatctccaccatcgac
cacgggttcaacgcgtcgaccttcaccgcgcgggtcatcgcgtcgacgggtgcggatgtc
gcggcctgcctggccggcgcggtgtcggcgttgtccggcccgctgcacggcggcgcgccc
agccgggcgctggacaccctggacgcgatcggcacgcccgatcgcatcgacgcgtggatc
cgcgagcgggtgctcgccggtgaccgcatcatgggcttcggccacgccgtctaccgcacg
gaggacccgcgctcacggatgctgcgtgaggtggcgcagagcttcggcggaccgcgcgtg
gagttcgccgtcgaggtggagcggcaggtcgaggcgatcctcgcggagctgaagccgggg
cgcgaactgcacaccaacgtcgagttctacgcgggcgtggtcatggaactgtgcggtctg
ccccgcgagatgttcactcccacgttcgcggcggcacgggtggtgggctggagcgcgaac
attctggagcaggcgtccgactccaagatcatccgtccggcggcgcggtatgtggggccg
ggggcgccggtcggggtcccggcggtggcctga

DBGET integrated database retrieval system