KEGG   Streptomyces coelicolor: SCO5845Help
Entry
SCO5845           CDS       T00085                                 

Gene name
SC9B10.12
Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sco  Streptomyces coelicolor
Pathway
sco00240  Pyrimidine metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCO5845 (SC9B10.12)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SCO5845 (SC9B10.12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14
Motif
Other DBs
NCBI-GeneID: 1101287
NCBI-ProteinID: NP_629968
Kitasato: SCO5845
UniProt: O50519
Position
6399582..6400232
Genome map
AA seq 216 aa AA seqDB search
MPELVFFSGTMDCGKSTLALQIEHNRSARGLAGMIFTRDDRAGEGKLSSRLGLVTDAVEV
GDGQDLYAHVVDHLSQGGRVDYVIADEAQFLAPDQIDQLARVVDDLDVDVYAFGITTDFR
SKLFPGSQRLVELADRVEVLQVEALCWCGARATHNARTVGGVMVVEGAQVVVGDVAQSPD
EIGYEVLCRRHHRRRMTSATARAAALSPDVLPVTAT
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctggtgttcttctccggaacgatggactgcgggaagtcgacactggctctc
cagatcgagcacaaccgctcggcgcgcggactggccggcatgatcttcacccgcgacgac
cgtgcgggcgagggcaagctctcctcccgcctcggcctcgtcaccgacgcggtcgaggtc
ggggacggccaggacctgtacgcccacgtcgtcgaccacctctcgcagggcggccgggtg
gactacgtgatcgcggacgaggcgcagttcctcgcgccggaccagatcgaccagctcgcg
cgcgtggtcgacgacctcgacgtcgacgtgtacgccttcggcatcaccaccgacttccgc
tccaagctcttcccgggctcccagcggctggtggaactcgccgaccgggtcgaggtgctc
caggtcgaggccctgtgctggtgcggagcccgcgccacgcacaacgcccgcaccgtgggc
ggcgtcatggtcgtcgagggcgcccaggtggtcgtcggggacgtcgcccagtcccccgac
gagatcggctacgaggtgctgtgccgccgccaccaccgcaggcggatgacgagcgccacg
gcgcgggcggcggcgctctcgccggacgtgctgccggtcaccgccacgtga

DBGET integrated database retrieval system