KEGG   Streptomyces coelicolor: SCO5879Help
Entry
SCO5879           CDS       T00085                                 

Gene name
redW
Definition
(RefSeq) acyl-coa dehydrogenase RedW
  KO
K21782  L-prolyl-PCP dehydrogenase [EC:1.3.8.14]
Organism
sco  Streptomyces coelicolor
Pathway
sco00333  Prodigiosin biosynthesis
sco01130  Biosynthesis of antibiotics
Module
sco_M00838  Undecylprodigiosin biosynthesis, L-proline => undecylprodigiosin
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SCO5879 (redW)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.14  L-prolyl-[peptidyl-carrier protein] dehydrogenase
     SCO5879 (redW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2 HpaB_N
Motif
Other DBs
NCBI-GeneID: 1101321
NCBI-ProteinID: NP_630001
Kitasato: SCO5879
UniProt: O54143
Position
6436613..6437788
Genome map
AA seq 391 aa AA seqDB search
MNFDFDAGFDTETRELRDMVVRFARRELDSSGRFDDAEDFRRRWLLAGKQGLTGTTVPGE
YGGSGLDAVSAAATMEALGYGCADTGFAFSVAAHLFAAVMPIVEFGTGEQRAAWLPALCS
GERIAAHAITEPEAGSDALHLRTRARPVDDGHVLSGSKCFITNAPVADVFVVQAATDPRG
GFFGLTTFLVEASTPGLTVGRPYDKVGLRGSPTADVHFDDCYVPAGAVLGAEGSGASIFS
SSMKWERTCLFAAYLGAMRRVLESTVDHVRDREQFGSPIGGFQAVSHRIVDMLGRYEGAR
LLLYRAARSLSDGTADEVGPALAKIAVSEAAVQLGLDAVQLRGGLGIMDGEAETLLRDAL
PARIFSGTNEIQKNNVARALGLGRRRPAARR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgacttcgacgccgggttcgacaccgagaccagggaactgcgcgacatggtc
gtgcggttcgcccggcgcgagctggactcctccggccgtttcgatgatgccgaggacttc
cggcggcgctggctgctggccggcaagcagggcctgaccggcaccaccgtgcccggtgag
tacggcggcagcggactggacgcggtgtccgcggccgccacgatggaggcgctcggctac
ggctgcgcggacaccggcttcgccttctcggtcgccgcgcatctgttcgccgccgtcatg
ccgatcgtcgagttcggcaccggggagcagcgtgccgcgtggttgccggccctgtgctcc
ggcgagcggatcgccgcgcacgccatcaccgagccggaggccggttcggacgcgctgcac
ctgcgcacccgcgcccgccccgtcgacgacggccatgtgctcagcggctccaagtgcttc
atcaccaacgcccccgtggccgacgtgttcgtggtgcaggccgccaccgatccgcggggc
ggcttcttcggactgaccaccttcctggtcgaggcatccacaccgggactcacggtgggc
cgtccgtacgacaaggtgggcctgcgcggctcccccaccgccgacgtccacttcgacgac
tgctacgtcccggccggcgcggtgctgggcgccgagggctccggggcgagcatcttctcc
tcctcgatgaagtgggagcgcacctgcctcttcgcggcctacctcggagcgatgcgccgg
gtgctggagtccacggtggaccacgtccgggaccgcgagcagttcggctcgcccatcggc
ggcttccaggcggtcagccaccgcatcgtcgacatgctgggccgctacgagggggcccgg
ctgctcctgtaccgcgccgcccgttccctgtccgacggcacggcggacgaggtcggcccg
gctctcgcgaagatcgcggtcagtgaggcggccgtacaactcggactggacgccgtccag
ttgagaggtgggctggggatcatggacggggaggcggagaccctgctgcgggacgcgctg
cccgcccggatcttctccggcaccaacgagatccagaagaacaacgtcgcgcgagcgctg
ggcctcgggcgccggcgtcccgcggcccgccgctga

DBGET integrated database retrieval system