KEGG   Streptomyces coelicolor: SCO5889Help
Entry
SCO5889           CDS       T00085                                 

Gene name
redO, SC3F7.09
Definition
(RefSeq) hypothetical protein
  KO
K21781  peptidyl carrier protein
Organism
sco  Streptomyces coelicolor
Pathway
sco00333  Prodigiosin biosynthesis
sco01130  Biosynthesis of antibiotics
Module
sco_M00838  Undecylprodigiosin biosynthesis, L-proline => undecylprodigiosin
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SCO5889 (redO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-GeneID: 1101331
NCBI-ProteinID: NP_630010
Kitasato: SCO5889
UniProt: O54152
Position
6445654..6445917
Genome map
AA seq 87 aa AA seqDB search
MTPRKLITDYIADAWMGGDAEGLEPDTPIAELNIIDSAAIFDLVHYLQGEFRVTVPLPEV
TLQNFRSVNAICALVDRLRQNEGGTAA
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgactcctcggaaactgatcaccgactacatcgccgacgcctggatgggcggcgacgcc
gaaggcctggagccggacacccccatcgcggagctgaacatcatcgactccgccgccatc
ttcgacctcgtccactacctgcagggcgagttccgcgtcacggtgccgctgccggaggtc
accctgcagaacttcaggtccgtcaacgcgatctgcgccctggtcgaccggctccggcag
aacgaggggggaaccgcggcatga

DBGET integrated database retrieval system