KEGG   Streptomyces coelicolor: SCO5976Help
Entry
SCO5976           CDS       T00085                                 

Gene name
arcB, StBAC16H6.11
Definition
(RefSeq) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
sco  Streptomyces coelicolor
Pathway
sco00220  Arginine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SCO5976 (arcB)
Enzymes [BR:sco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     SCO5976 (arcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-GeneID: 1101418
NCBI-ProteinID: NP_630092
Kitasato: SCO5976
UniProt: Q93JF1
Position
6550399..6551406
Genome map
AA seq 335 aa AA seqDB search
MATVPTALAGRHFLKELDFTEEEFRGLIELAAELKAAKRAGTETRYLQGRNIALIFEKTS
TRTRCAFEVAAADQGASTTYLDPAGSQIGHKESVKDTARVLGRMFDGIEYRGDSQTKVEE
LAAFAGVPVYNGLTDDWHPTQMLADVLTMTEHSDRPLREITFAYLGDARFNMGNSYLVTG
ALLGMDVRIVAPKSYWPAQEVVDRAHRLAAASGARITLTEDVAEGVRGAGFVVTDVWVSM
GEPKEVWAERIKALAPYAVTMDVLRATGNPDVRFLHCLPAFHDLGTKVGQEIFEAHGLDS
LEVTDEVFESAHSVVFDEAENRLHTIKAVLVATLA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagtcccgaccgccctcgccggccgccacttcctcaaggagctggacttcacc
gaggaggagttccgcggcctgatcgagctggccgcggagctgaaggccgcgaagcgggcc
gggacggagacgcggtacctccagggcaggaacatcgcgctgatcttcgagaagacctcg
acgcgcacccgctgcgcgttcgaggtcgccgccgccgaccagggcgcctccacgacgtac
ctcgacccggccgggtcgcagatcggccacaaggagtccgtgaaggacaccgcccgcgtc
ctcggccgcatgttcgacggtatcgagtaccgcggcgacagccagaccaaggtcgaggaa
ctggcggccttcgcgggcgtccccgtctacaacggcctgaccgacgactggcaccccacc
cagatgctcgccgacgtgctcacgatgaccgagcacagcgaccgccccctgcgggagatc
accttcgcctacctcggcgacgcccgcttcaacatgggcaactcctacctggtcaccggc
gccctgctcggcatggacgtgcgcatcgtcgccccgaagtcctactggcccgcccaggag
gtcgtcgaccgggcgcaccggctcgccgcggccagcggggcgcgcatcaccctcaccgag
gacgtggccgaaggggtgcggggcgccgggttcgtcgtcacggacgtctgggtctccatg
ggcgagcccaaggaggtctgggcggagcggatcaaggcactcgcgccctacgccgtgacc
atggacgtgctgcgcgccaccggcaacccggacgtcaggttcctgcactgcctgcccgcc
ttccacgacctgggcaccaaggtgggccaggagatcttcgaggcccacgggctcgactcc
ctggaggtcaccgacgaggtcttcgagtcggcgcactcggtcgtcttcgacgaggcggag
aaccgcctgcacaccatcaaggccgtcctcgtcgccaccctcgcctga

DBGET integrated database retrieval system